KEGG   Burkholderia sp. CCGE1002: BC1002_1785Help
Entry
BC1002_1785       CDS       T01217                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
bge00300  Lysine biosynthesis
bge01100  Metabolic pathways
bge01120  Microbial metabolism in diverse environments
bge01230  Biosynthesis of amino acids
Module
bge_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:bge00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    BC1002_1785
Enzymes [BR:bge01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BC1002_1785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: ADG15849
UniProt: D5W8V4
Position
1:1993211..1994350
Genome map
AA seq 379 aa AA seqDB search
MSGTLALTEQLIARASVTPDDQHCQRLLIERLAALGFEHETIESNGVTNLWAVKRGADGT
EGKLLAFAGHTDVVPTGPLEQWQSAPFEPTQRDGKLYGRGAADMKASIAGFVVASEEFVA
ANPQHRGSIAFLITSDEEGPATDGTVKVVDALQQRGERMDYCIVGEPTSSERFGDMVKNG
RRGSMSGKLTVKGVQGHIAYPHLAKNPVHLLAPALAELVAERWDEGNEYFPPTTWQVSNL
HSGAGATNVIPGHADVMFNFRFSTASTVEGLQKRVHAILDKHGLEYELHWTISGLPFLTP
RGELSSALAKAIKDETGVDTELSTTGGTSDGRFIARICKQVIEFGPLNASIHKIDEHIEV
AHIEPLKNVYRRVLEQLIA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtccggcaccctagcccttaccgaacaactgatcgcgcgcgcgtccgtgacgcccgac
gaccagcattgccagcgtctgctgatcgagcgcctggccgcgctcggcttcgagcacgag
acgatcgaatccaacggcgtgaccaacctgtgggccgtcaagcgcggcgccgacggcacc
gagggcaagctgctcgcgttcgccggccacaccgacgtggtgccaaccggcccgctcgaa
caatggcagtcggcgccgttcgagccgacccagcgcgacggcaagctgtacggccgcggc
gcggcggacatgaaggcatcgatcgccggcttcgtcgtcgcgagcgaggagttcgtcgcg
gccaaccctcagcaccgcggctcgatcgcgttcctgatcacgagcgatgaggaaggcccc
gccaccgacggcaccgtcaaagtcgtcgacgcgttgcaacagcgcggcgagcgcatggac
tactgcatcgtcggcgaaccgacgtcgagcgagcggttcggcgacatggtcaagaacggc
cggcgcggttcgatgtcgggcaagctgaccgtcaagggcgtgcaaggtcatatcgcttat
ccgcatctggccaagaatccggtgcacctgctcgcgcccgcgcttgccgagctcgtcgcc
gaacgctgggacgaaggcaacgaatatttcccgccgaccacctggcaggtgtcgaacctc
cacagcggcgccggtgcgaccaacgtgatccccggccatgcggacgtgatgttcaacttc
cgcttctcgaccgcgagcaccgtcgaaggactgcaaaagcgcgtgcacgcgattctcgac
aaacacggcctcgaatacgaactgcactggacaataagcggcctgccgtttctcaccccg
cgcggcgaactgtcgagcgcgctcgcaaaggcgatcaaggacgagaccggcgtggacacc
gagctatcgaccaccgggggcacgtcggacggccgcttcatcgcgcgcatctgcaagcag
gtgatcgagttcggtccgctgaacgcaagcatccacaagatcgacgaacatatcgaagtc
gcccatatcgagccgctgaagaacgtgtatcgccgcgtgctcgaacaactgatcgcataa

DBGET integrated database retrieval system