KEGG   Burkholderia sp. CCGE1002: BC1002_1902Help
Entry
BC1002_1902       CDS       T01217                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
bge00010  Glycolysis / Gluconeogenesis
bge00020  Citrate cycle (TCA cycle)
bge00620  Pyruvate metabolism
bge01100  Metabolic pathways
bge01110  Biosynthesis of secondary metabolites
bge01120  Microbial metabolism in diverse environments
bge01130  Biosynthesis of antibiotics
bge01200  Carbon metabolism
Module
bge_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bge00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC1002_1902
   00020 Citrate cycle (TCA cycle)
    BC1002_1902
   00620 Pyruvate metabolism
    BC1002_1902
Enzymes [BR:bge01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BC1002_1902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N HlyD_D23 DEC-1_N HlyD_3 CAT
Motif
Other DBs
NCBI-ProteinID: ADG15965
UniProt: D5W970
Position
1:complement(2127311..2128993)
Genome map
AA seq 560 aa AA seqDB search
MSQAIEVKVPDIGDYKDVPVIEVLVKAGDTVEKEQSLVTLESDKATMDVPSSADGVVKEV
KVKVGDAVSEGTLIVVLEGANAAAAAPAPAAAPAPAPAPAAAPAAAPAPAPAPAPAPAPA
AAGGGVQEIKVPDIGDYKDVPVIEIAVKVGDRVEKEQSLVTLESDKATMDVPSSAAGVVK
EVKVKVGDNVSEGSVIVVIEAEGGAAAAPAPAPAVKAPTEKPSDAPATPSPAPAAPSALA
QAPLIPAGEGGTRHPSHASPSVRKFARELGVDVSQVKGTGPKGRITQADVTAFVKGVMTG
QRAAPAGAAAPAAGGGELNLLPWPKVDFTKFGPIDPKPLSRIKKISGANLHRNWVMIPHV
TNNDEADITELEALRVKLNKEHEKAGVKFTMLAFVIKACVAALKKFPTFNASLDGDNLVF
KQYYHIGFAADTPNGLVVPVIRDADKKGLVDIAKEMADLSKAAREGKLKPDQMQGGCFSI
SSLGGIGGTHFTPIINAPEVAILGLSRSAMKPVWDGKQFEPRLTMPLSLSYDHRVIDGAE
AARFNAYLGSILADFRRVIL
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagcgatcgaagtcaaggtgccggacatcggcgattacaaggacgtccctgtg
atcgaggtgctggtaaaggcgggtgacaccgtcgaaaaagagcaatcgctcgttacgctg
gaatccgacaaggcgacgatggacgtgccgagctcggctgacggcgtcgtcaaggaagtg
aaggtcaaggtcggcgatgcggtgtccgaaggcacgctgatcgtcgtgctggaaggcgcc
aacgcggctgccgcggcgcccgcgccggcggcggctccagcgcccgcaccggcaccggcg
gcggctcccgctgcggcacccgcacccgcacccgcacccgcacccgcacccgcacctgcg
gcggcaggcggcggcgtgcaggaaatcaaggtgccggatatcggcgactacaaagacgtt
cccgtgatcgagatcgcggtgaaggtcggcgaccgcgtcgagaaggaacagtcgctcgtc
acgctcgaatccgacaaggcgacgatggacgtgcccagctcggccgccggcgtcgtcaag
gaagtgaaggtcaaggttggcgataacgtgtcggaaggctcggtcatcgtcgtgatcgaa
gcggaaggcggcgctgccgcggcacccgcgccggcaccggccgtgaaggcgccaactgaa
aagccgtccgacgcaccggccacgccgagcccggcaccggccgcgccgtccgcgctcgcg
caggcgccgctgatcccggcgggcgaaggcggcacgcgtcatccgagccacgcttcgccg
tcggtgcgcaagttcgcgcgcgaactcggcgtcgacgtgagccaggtgaagggcacgggt
ccgaagggccgcattacgcaggccgacgtgaccgcgttcgtgaagggcgtgatgaccggc
cagcgcgcggcgccggcaggagccgccgcgccggccgccggcggtggcgaactgaatctg
ctgccgtggccgaaggtcgacttcacgaagttcggtccgatcgatccgaagccgctgtcg
cgcatcaagaagatctcgggcgcgaacctgcatcgcaactgggtcatgatcccgcacgtc
acaaacaacgacgaagcggacatcaccgagctcgaagcgctgcgcgtgaagctgaacaag
gaacacgaaaaggcgggcgtcaagttcacgatgctcgcgttcgtgatcaaggcctgcgtg
gcggccctgaagaaatttccgaccttcaacgcgagcctcgacggcgacaacctggtgttc
aagcagtactaccacatcggttttgccgcggacacgccgaacggcctcgtcgttccggtg
attcgcgacgcggacaagaagggtctcgtcgacatcgcgaaggaaatggccgacctgtcg
aaggccgcgcgcgaaggcaagctgaagccggaccagatgcagggtggctgcttctcgatc
tcgtcgctgggcggtatcggcggcacgcacttcacgccgatcatcaatgcgcctgaagtc
gcgattctcggcctgtcgcgcagcgcgatgaagccggtgtgggacggcaagcagttcgag
ccgcgcctgaccatgccgctgtcgctgtcgtacgaccatcgcgtgatcgacggagcggaa
gccgcgcgcttcaacgcatacctcggttcgattcttgccgatttccggcgtgtgattctt
tga

DBGET integrated database retrieval system