KEGG   Burkholderia sp. CCGE1002: BC1002_1985Help
Entry
BC1002_1985       CDS       T01217                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
bge00010  Glycolysis / Gluconeogenesis
bge00620  Pyruvate metabolism
bge00640  Propanoate metabolism
bge00680  Methane metabolism
bge01100  Metabolic pathways
bge01110  Biosynthesis of secondary metabolites
bge01120  Microbial metabolism in diverse environments
bge01130  Biosynthesis of antibiotics
bge01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bge00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC1002_1985
   00620 Pyruvate metabolism
    BC1002_1985
   00640 Propanoate metabolism
    BC1002_1985
  Energy metabolism
   00680 Methane metabolism
    BC1002_1985
Enzymes [BR:bge01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BC1002_1985
Lipid biosynthesis proteins [BR:bge01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BC1002_1985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ADG16046
UniProt: D5W9J1
Position
1:complement(2227191..2228855)
Genome map
AA seq 554 aa AA seqDB search
MNLDGETYDSLTANFTWRIPQRYNIGVDACDKWADGSGRLALIYEDADGRATRYTFDELK
ALSDRFANVLLAAGARRGERIGIFLSQSIETAIAHLAAYKAGLVAVPLFALFGVDALEHR
LGDSGALALITDQAGVQKIDEIRGALPGLRHVFSVDIEQDDEASDAPVRSFWQALHGAPA
EFTPVDTAADDPAIIIYTSGTTGKPKGALHGHRVLLGHLPGVEMSQQGFPAHATLMWTPA
DWAWIGGLFDVLLPSWHHGVAVLARRFAKFDGHAAFDLLARHAVSHAFLPPTALKMMRGV
ERPAHLRLALRSVASGGESLGEELIGWGRDALGVTINEFYGQTECNVVVSSCAALFEPRF
GAIGRAVPGHHVAIVDAAGNELPPGAIGDIAVASPDPVMFVGYWRNEAATREKFRGKFLL
TGDLGTRDVDGFIRFVGRGDDVITSAGYRIGPASIEDSLLRHPAVAMAAVVGAPDRERTE
IVMAFVVLKAGFVGDDALVREIQQHVKTRLAAHEYPREIRFVESLPMTATGKVIRKALRE
AVTHDPDATPPAKN
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaacctcgatggcgagacttacgattcgctcacggccaatttcacgtggcgcattcca
cagcgctataacataggcgtcgacgcatgcgacaagtgggccgatggctcggggcgtcta
gcgttgatctacgaagatgccgacggccgcgcgacccgctatacgttcgatgaactgaaa
gccctgtccgaccgcttcgccaatgtgctgctagcggcgggcgcgcggcgcggcgagcgc
atcggcatcttcctgtcgcaatcgatcgaaacggccatcgcgcatcttgcggcctacaag
gcaggcctggtcgcggtgccgttgttcgcgctgttcggcgtggacgcgctcgagcatcgg
ctcggcgacagcggtgcgctcgcgctgatcaccgatcaggccggcgtgcaaaaaatcgac
gaaatccgcggcgcgctgcccgggttgcgacacgtgttcagcgtcgatatcgagcaggat
gacgaagcatcggacgcacccgtgcggtcgttctggcaggcgttgcatggcgctcccgct
gagttcacgccggtcgataccgccgcggacgatccggcgatcatcatctatacgtcgggc
acgaccggaaaaccgaagggcgcgttgcacgggcatcgcgtgttgctcgggcatctgccc
ggcgtcgagatgtcgcagcagggctttcccgcccacgcgacgctgatgtggacgcccgcg
gactgggcgtggatcggcggtctgttcgacgtgctgctgccgtcgtggcatcacggcgtc
gcggtgctcgcgcgccgttttgcgaaattcgacggccacgccgcgttcgatctgctcgcg
cgtcacgcggtttcccatgcgtttttaccgccgaccgcgctgaagatgatgcgtggcgtc
gagcggcccgctcatctgcggcttgcattgcgatcggtcgcgagcggcggcgaatcgctg
ggcgaggaactgatcggctgggggcgcgacgcgctcggcgtgacgatcaacgagttctac
ggacagaccgagtgcaacgtcgtcgtgtcgtcgtgcgcggcgctgttcgagccgcgcttc
ggcgcgatcgggcgcgcggtgccggggcaccatgtcgcgatcgtcgatgccgccggcaac
gaactgccgcccggcgcgatcggcgatatcgccgtggcctcgcccgatccggtgatgttt
gtcggctactggcgcaacgaggcggcgacgcgcgagaaattccgcggcaagtttctgctg
accggcgatctcggcacgcgcgacgtggacggcttcattcgcttcgtcgggcgcggcgac
gacgtgatcacgagcgccggctaccggatcgggccggcgtcgatcgaagattcgctgctg
cgtcatcccgccgtcgcgatggcggccgtggtcggcgcgcccgatcgcgagcgcaccgaa
atcgtgatggcgttcgtcgtgctgaaagcgggcttcgtcggcgacgatgcgctggtgcgc
gagatccagcagcacgtaaagacgcgtctggctgcgcacgaatatccgcgcgagattcgc
ttcgtcgaaagcctgccgatgacggccaccggcaaggtgatccgcaaggcactgcgcgag
gcggtgacgcacgacccggacgcgaccccgccggcgaaaaactga

DBGET integrated database retrieval system