KEGG   Burkholderia sp. CCGE1002: BC1002_2091Help
Entry
BC1002_2091       CDS       T01217                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
bge00790  Folate biosynthesis
bge01100  Metabolic pathways
Module
bge_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bge00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BC1002_2091
Enzymes [BR:bge01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     BC1002_2091
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind BRICHOS
Motif
Other DBs
NCBI-ProteinID: ADG16150
UniProt: D5WA70
Position
1:complement(2346725..2347690)
Genome map
AA seq 321 aa AA seqDB search
MRAGVLHTGPFCIYPFKVKHCYVSKVDSSSVPLPEPLQCGRFKLTFERPLVMGILNVTPD
SFSDGGLYAMRGDALRQAERMMLAGADIIDIGGESTRPGAPPVPLDEELERVIPLVEQLR
GANVPLSVDTYKPEVMRSALNAGADLINDVWAFRMPGAIDAVRDSDCGLCVMHMLGEPQT
MQRGEPHYADVVSEVRQFLEERVATLQQAGIARERISVDPGFGFGKVVVEHNYALLAHLR
DTAPRAASPYPILAGMSRKSMVGAVTGRPAPERVAGSVAAAVCAAERGAAILRVHDVAQT
VDALKVWATLRDAARRSRAHG
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
gtgcgggccggtgtgctacacaccggcccgttttgcatttatccgttcaaagtgaagcat
tgctacgtgtcgaaagtcgattcttcttccgtaccccttccagagccgctgcagtgcggc
cgcttcaagctgacgtttgaacgcccgttggttatgggcatcctgaacgtcactcccgat
tccttctccgatggcggcttgtacgcgatgcgcggcgatgcgctgcgccaggccgagcgc
atgatgctcgcgggcgcggacattatcgatatcggcggggaatcgacgcgtcctggcgcg
ccgccggtgccgctcgacgaagagctcgagcgcgtgataccgctcgtcgagcaactgcgt
ggcgcgaacgtgccgttgtcggtcgatacctacaagccggaagtgatgcggagcgcgttg
aacgcgggcgccgacctgatcaacgacgtctgggcgttccgcatgcccggcgcaatcgat
gccgtgcgcgacagcgattgcggcctttgtgtaatgcatatgttaggtgagccgcagacc
atgcagcgcggcgagcctcactatgccgacgttgtcagcgaagtgcgccagttcctcgag
gagcgtgtcgcgacattgcagcaggcggggattgcacgcgagcgtatcagcgtcgatccg
ggcttcggcttcggcaaggtcgtcgtcgagcacaactacgcgttgctcgcgcatctgcgc
gacacggcgccgcgcgccgcctcgccatatccgatccttgcgggcatgtcgcgcaagtcg
atggttggcgcggtgaccgggcggccggcgccggagcgcgtggccggcagcgtcgccgcg
gcggtgtgtgcggccgagcggggcgccgcgattctgcgcgtacacgacgtcgcgcaaaca
gtcgatgcattgaaagtatgggcaaccctgcgcgacgcggccaggcggagccgcgcgcac
ggttga

DBGET integrated database retrieval system