KEGG   Burkholderia sp. CCGE1002: BC1002_2284Help
Entry
BC1002_2284       CDS       T01217                                 

Definition
(GenBank) Inositol phosphatase/fructose-16-bisphosphatase
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
bge00010  Glycolysis / Gluconeogenesis
bge00030  Pentose phosphate pathway
bge00051  Fructose and mannose metabolism
bge00680  Methane metabolism
bge00710  Carbon fixation in photosynthetic organisms
bge01100  Metabolic pathways
bge01110  Biosynthesis of secondary metabolites
bge01120  Microbial metabolism in diverse environments
bge01130  Biosynthesis of antibiotics
bge01200  Carbon metabolism
Module
bge_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC1002_2284
   00030 Pentose phosphate pathway
    BC1002_2284
   00051 Fructose and mannose metabolism
    BC1002_2284
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BC1002_2284
   00680 Methane metabolism
    BC1002_2284
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bge04147]
    BC1002_2284
Enzymes [BR:bge01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     BC1002_2284
Exosome [BR:bge04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BC1002_2284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase
Motif
Other DBs
NCBI-ProteinID: ADG16343
UniProt: D5WB38
Position
1:2558529..2559545
Genome map
AA seq 338 aa AA seqDB search
MSLQRRTTLTKYLIEQQRETNNLPADLRLLIEVVARACKAISYHVSKGALGDALGSAGSE
NVQGEVQKKLDILSNEILLEANEWGGNLAGMASEEMEQFFPIPANYPKGEYLLVFDPLDG
SSNIDVNVSIGTIFSVLRCPDGHQATEQSFLQPGTEQVAAGYAVYGPQTVLVLTTGNGVN
CFTLDRELGSWVLTQSDMRIPVETREYAINASNERHWYPPVQQYIGELKAGKEGSRQADF
NMRWIASMVADVHRILNRGGIFMYPADKRTPDKPGKLRLMYEANPMAFIVEQAGGAATNG
EKRILDIQPKSLHERVAVFLGSKNEVDRVTRYHLEAKK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtcattgcaacgtcgtaccactctcacgaagtacctgatcgagcagcagcgtgaaacc
aacaacctgcccgccgatctgcgcctgttgatagaagtcgtcgcgcgcgcgtgcaaggcg
atcagctaccacgtcagcaagggcgcgctcggcgatgccctcggctcggcgggcagcgaa
aacgtccagggcgaagtgcagaagaagctcgacatcctgtcgaacgaaattctgctcgag
gcgaacgaatggggcggcaacctcgcgggcatggcctccgaggaaatggaacagttcttc
ccgattccggccaactatccgaagggcgaatatctgctcgtgttcgatccgctcgacggc
tcgtcgaacatcgacgtcaacgtgtcgatcggcacgatcttctcggtgctgcgttgcccg
gatggccaccaggccaccgagcaatcgttcctgcagccgggcacggagcaggtcgccgcg
ggctacgcggtgtacggcccgcaaacggtgctggtgctgaccaccggtaacggtgtgaac
tgcttcacgctcgatcgcgagctcggctcgtgggtgctcacgcaaagcgacatgcgtatt
ccggtcgaaacgcgcgagtacgcgatcaacgcttcgaacgaacgccactggtatccgccg
gttcagcaatacatcggcgaactgaaagcaggcaaggaaggttcgcgtcaggctgacttc
aacatgcgctggatcgcatcgatggtcgccgacgtgcatcgcatcctgaatcgcggcggc
atctttatgtacccggccgacaagcgcacgccggacaagccgggcaagctgcgtctgatg
tacgaagccaatccgatggcgttcatcgtcgagcaggcgggcggtgctgcaaccaacggc
gagaagcgtattctcgacatccagcccaagagcctgcacgagcgcgtcgcggtgttcctc
ggctcgaagaatgaggtcgatcgcgtgacgcgctaccacctcgaagcgaagaagtga

DBGET integrated database retrieval system