KEGG   Burkholderia sp. CCGE1002: BC1002_2339Help
Entry
BC1002_2339       CDS       T01217                                 

Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
bge00860  Porphyrin and chlorophyll metabolism
bge01100  Metabolic pathways
bge01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bge00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BC1002_2339
Enzymes [BR:bge01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     BC1002_2339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: ADG16397
UniProt: D5WBL9
Position
1:2611287..2612672
Genome map
AA seq 461 aa AA seqDB search
MSLADTLFRPDLLARYSANGPRYTSYPTAPQFRESFDTADYHRAAADPGAASTDLSLYFH
IPFCDTVCFYCGCNKVVTKNRAHARPYLERLKREIALQAACFDTQRPVSQLHWGGGTPTF
LSHDEMSELMAATREHFNLLPDTEAEYSIEVDPREASPDTIALLRHLGFNRLSLGVQDFD
PRVQQAINRMQPFEMTASVMQAARAHGFHSIGVDLIYGLPHQTVASFSRTLDTMLELAPD
RLSVFAYAHMPQLFKMQRQMDAATLPSSEERLALLQRVVERLTGAGYVYIGMDHFALPTD
ELARAQAQRTLHRNFQGYSTRAECDLIGFGASSIGKVGDVYAQNARELPAYTDAIDAGRL
AIARGIRLSADDRLRRDVITQLMCNLELRFDEFEAAYGIHFGDTFAPELARLRAFEDDGL
ISLRARKLEVRMAGRMLVRNLAMVFDRYLGEQTLTRFSRTV
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgtccctagccgacaccctgttccgccccgacctactcgcgcgctacagcgcgaatggt
ccccggtacacgtcctatccaactgcgccgcagttccgcgagtcgttcgacaccgccgac
tatcatcgcgccgccgccgacccgggtgccgcgtcgaccgatctgtcgctgtacttccac
attccgttttgcgacaccgtgtgcttctactgcggctgcaataaggtcgtgacgaaaaac
cgcgcgcatgcgcggccgtacctggaacggctcaaacgcgaaatcgccttgcaggcagcg
tgtttcgatacgcagcggcccgtgtcgcagttgcattggggcggcggcacaccgacgttt
ttgtcgcatgacgagatgagcgagttgatggccgcgacgcgcgagcacttcaatctgctg
cccgacactgaagccgagtattcgatcgaggtcgatccgcgcgaggcgtcgcccgacacg
atcgcgctgctgcgccatctcggcttcaaccggctgagcctcggcgtgcaggacttcgat
ccgcgcgtgcaacaggcgatcaatcgcatgcagccgttcgagatgaccgcatcggtgatg
caagcggcgcgcgcacacggttttcattcgatcggggtcgatctgatttacggcctgccg
catcaaacggtcgcgagcttcagccgcacgctcgacacgatgctcgaactcgcgccggac
cggctgtcggtgttcgcgtatgcgcacatgccgcagctcttcaagatgcagcggcagatg
gatgccgcgacgctgccgtcgagcgaggagcggctcgcgctgctgcaacgggtggtcgag
cggctgacgggggcgggttatgtgtacatcggcatggatcacttcgcgctgcccaccgac
gagctcgcgcgcgcgcaggcacagcgcacgctgcaccgcaatttccagggctatagcacg
cgggccgaatgcgatctgatcggcttcggcgcctcgtcgatcggcaaggtcggcgacgtg
tacgcgcagaacgcgcgagagctgcccgcctacaccgacgcgatcgacgcgggccggctc
gcgatcgcgcgcggcatccgcctgtccgccgacgaccgtctgcggcgcgacgtgatcacg
cagctgatgtgcaacctcgaactgcgcttcgacgaattcgaggcggcgtacggcatccac
ttcggcgacacgttcgcgccggagctagctcgtctgcgcgcattcgaggacgacgggctg
atctcgctccgcgcgcgcaagctcgaagtgaggatggccggccgcatgctcgtgcgcaat
ctcgcgatggtattcgaccgctatctcggcgagcagacgctcacacggttctcgcgcacg
gtttga

DBGET integrated database retrieval system