KEGG   Burkholderia sp. CCGE1002: BC1002_2757Help
Entry
BC1002_2757       CDS       T01217                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
bge00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bge01100  Metabolic pathways
bge01110  Biosynthesis of secondary metabolites
bge01130  Biosynthesis of antibiotics
bge01230  Biosynthesis of amino acids
Module
bge_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bge00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BC1002_2757
Enzymes [BR:bge01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BC1002_2757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C ThiG
Motif
Other DBs
NCBI-ProteinID: ADG16805
UniProt: D5W4Y7
Position
1:3069894..3070679
Genome map
AA seq 261 aa AA seqDB search
MSDILDRIIAVKREEIRAAEQSAPLEELRLEASSRDLRDFVGAIRAKHAAGLAAVISEVK
KASPSKGVLREHFVPADIARSYEKHGAACLSVLTDVQFFQGSVAYLQQARAACQLPVIRK
DFIVDPYQVVEARAMGADAILLIAAALETAEMQDLEALAHSLGLAVLVEVHDSDELKEAL
TLKTPLIGINNRNLRTFETSLDTTLGMLDAIPDDRIVVTESGILSRDDVERMRARNVHTF
LVGEAFMRADEPGVELARMFF
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacattctcgaccgcatcatcgcggtcaaacgcgaagaaatccgggcggccgaa
caaagcgcaccgctcgaagaattgcggctcgaagcgtcgtcgcgcgatctgcgcgacttc
gtcggcgcaatccgcgccaagcacgcggcgggtctcgccgcggtgatctcggaagtgaag
aaggcgagcccgtcgaagggggtactgcgcgagcacttcgtgccggccgacatcgcacgt
tcgtacgagaagcacggcgcggcgtgtctgtccgtgctgaccgacgtgcagttcttccag
ggcagcgtcgcgtatctgcagcaagcgcgcgccgcgtgccagttgccggtgattcgcaag
gacttcatcgtcgatccgtatcaggtcgtcgaagcacgcgcgatgggtgccgacgcgatc
ctgctgatcgccgccgcgctcgaaaccgccgagatgcaggacctcgaagcgctcgcgcat
tcgctcggtctcgcggtgctcgtcgaagtgcatgacagcgatgaactcaaggaagcgctg
acgctgaagacgccgctgatcggcatcaacaaccgcaacctgcgcaccttcgaaacctcg
ctcgacacgacgctcggcatgctcgacgcgattccggacgaccgcatcgtcgtgaccgag
tcgggcatcctgtcgcgcgacgacgtcgagcgcatgcgcgcgcgcaacgtgcatacgttc
ctcgtcggcgaggcgttcatgcgcgcggacgagccgggcgtggaacttgcgcggatgttt
ttctga

DBGET integrated database retrieval system