KEGG   Burkholderia sp. CCGE1002: BC1002_2818Help
Entry
BC1002_2818       CDS       T01217                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
bge00340  Histidine metabolism
bge01100  Metabolic pathways
bge01110  Biosynthesis of secondary metabolites
bge01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bge00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    BC1002_2818
Enzymes [BR:bge01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     BC1002_2818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh Rieske
Motif
Other DBs
NCBI-ProteinID: ADG16866
UniProt: D5W548
Position
1:complement(3128411..3129745)
Genome map
AA seq 444 aa AA seqDB search
MSTKIRKLDSTARDFHKSLHAVLAFEASEDEAIERAVAQILNDVKARGDDAVLEYTNRFD
RIAAKSVAELELPMVELEAALESLEPKRRASLEAAAARVRGYHEKQKIECGSHSWQYTEA
DGTVLGQKVTPLDRAGIYVPGGKAAYPSSVLMNAIPARVAGVREIVMVVPTPDGVKNPLV
LAAALLGGVDRVFTIGGAQAVGALAYGTQTVPAVDKICGPGNAYVASAKRRVFGTVGIDM
IAGPSEILVLCDGTTDPRWVAMDLFSQAEHDELAQSILLCPDDAFIARVQEAIDELLPTM
PRHEVIRTSLENRGALIKVRDMAEACAIANDIAPEHLEISALEPHQWAQQIRHAGAIFLG
RYTSESLGDYCAGPNHVLPTSRTARFSSPLGVYDFFKRSSLIEVSAEGAQTLGEIAAELA
YGEGLQAHARSAEFRMRQNNNERG
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgtctaccaagattcgcaaactcgattccaccgctcgcgactttcacaagtcgctgcat
gcggtgctcgccttcgaggcgagcgaagacgaagccatcgagcgcgcggtcgcgcagatt
ctgaacgacgtgaaggcgcgtggcgacgacgcggtgctcgagtacacgaaccgcttcgat
cgcatcgccgcgaaaagcgtggccgagctcgaactgccgatggtggagctcgaagcggcg
ctcgaaagtctcgagcccaagcggcgtgcgtcgctcgaagcggcggcggcgcgcgtgcgc
ggctatcacgagaaacagaagatcgagtgcggcagccatagctggcagtacaccgaagcg
gacggcaccgtgctcggccaaaaggtcacaccgctcgatcgcgcgggcatctatgtgccg
ggcggtaaggccgcgtatccgtcgtcggtgctgatgaacgcgattccggcgcgggtggcc
ggcgtgcgcgaaatcgtgatggtcgtgccgacgccggacggtgtgaagaatccgctcgtg
ctcgcggctgcactgctcggcggcgtcgatcgcgtgttcacgatcggcggcgcgcaggcg
gtgggcgcactcgcgtacggcacgcaaacggtgcccgcggtcgacaagatttgcggcccg
ggcaacgcgtatgtcgcgtcggcgaagcgtcgcgtgttcggcacggtcggcatcgacatg
atcgccgggccgtcggaaatcctcgtgctgtgcgacggcacgaccgatccacgctgggtc
gcgatggacctgttctcgcaggccgagcacgacgaactcgcgcagtcgatcctgctgtgc
ccggacgacgcgtttatcgcgcgcgtgcaggaagcgatcgacgaactgctgcccacgatg
ccgcgccacgaagtgatccgcacgtcgctcgaaaaccgcggcgcgctgatcaaggtgcgc
gatatggccgaggcctgcgcgatcgccaacgacatcgcgccggagcacctcgaaatttcg
gcgctggagccgcatcagtgggcgcagcagatccgccacgcgggcgcgatcttccttggc
cgctacacgagcgagagcctcggcgactactgcgcgggcccgaaccacgtgctgccgacg
tcgcgtaccgcacggttctcgtcgccgctcggcgtctatgatttcttcaagcgttcgagc
ctgatcgaggtcagcgcggaaggcgcgcaaacgcttggcgagatcgccgccgaactcgca
tatggcgaaggtctgcaagcgcacgcacgcagcgccgaattccggatgcggcagaacaac
aacgaacgcggctga

DBGET integrated database retrieval system