KEGG   Burkholderia sp. CCGE1002: BC1002_3780Help
Entry
BC1002_3780       CDS       T01217                                 

Definition
(GenBank) GTP cyclohydrolase II
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
bge00740  Riboflavin metabolism
bge00790  Folate biosynthesis
bge01100  Metabolic pathways
bge01110  Biosynthesis of secondary metabolites
bge02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bge00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    BC1002_3780
   00790 Folate biosynthesis
    BC1002_3780
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BC1002_3780
Enzymes [BR:bge01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     BC1002_3780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: ADG17798
UniProt: D5WH53
Position
2:636909..637583
Genome map
AA seq 224 aa AA seqDB search
MPALLFNAMLTSQDSSPAADGAVTSECVVLDATATLPTRYGTFTSYVFRVVDSGAEHLAL
VMGDVANQSSVLTRLHSECLTGDVLGSYRCDCGEQLDLALRYIAAEGCGVLLYLRGHEGR
GIGLSNKIRAYALQEQGRDTVEANLDLGLPDDSREYDSAAGILRTLKVTSVRLMSNNPDK
FDTLSKHGIPVCERVALAIPMREENERYIRTKQLKFGHYFDENE
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgccagcactattgttcaacgccatgctcacgtctcaggattcatcgcccgcagcggac
ggcgccgtcacgagcgaatgcgtcgtgctcgacgccaccgccacgctgcccacgcgctac
ggcacgttcacttcctatgtgtttcgcgtggtcgacagcggcgccgaacatctcgcgctc
gtgatgggcgatgtcgccaaccagtcgtccgtgctgacgcgcctgcattcggaatgtctg
acgggcgacgtactcggctcctatcgctgcgactgcggcgagcagctcgatctcgcgctg
cgctatatcgcggctgagggttgcggcgtgctgctgtatctgcgcggccacgaaggacgc
ggcatcggcctgtcgaacaagatccgcgcgtatgcgcttcaggagcaggggcgcgatacg
gtcgaggccaacctcgatctcggcctgcccgacgattcacgcgaatacgattcggccgcg
ggcatcctgcgtacgctgaaggtcacgtcggtgcggctgatgagcaacaatcccgacaag
ttcgacacgttgtcgaagcacggcatcccggtgtgcgagcgtgtcgcgctcgcgattccg
atgcgcgaggaaaacgagcgctatatccgcaccaagcagctgaagttcgggcattacttc
gacgagaacgagtaa

DBGET integrated database retrieval system