KEGG   Burkholderia sp. CCGE1002: BC1002_3880Help
Entry
BC1002_3880       CDS       T01217                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
bge00430  Taurine and hypotaurine metabolism
bge00620  Pyruvate metabolism
bge00640  Propanoate metabolism
bge00680  Methane metabolism
bge01100  Metabolic pathways
bge01120  Microbial metabolism in diverse environments
bge01200  Carbon metabolism
Module
bge_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:bge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BC1002_3880
   00640 Propanoate metabolism
    BC1002_3880
  09102 Energy metabolism
   00680 Methane metabolism
    BC1002_3880
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BC1002_3880
Enzymes [BR:bge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     BC1002_3880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: ADG17892
UniProt: D5WHE7
Position
2:complement(754820..755971)
Genome map
AA seq 383 aa AA seqDB search
MHDHDQERTILVLNSGSSSLKFGLFAPSADDETLLLEGAAEGIGRTDGRLRIKAADGRVL
LQQDQKLDSQTEALQQLSQLLVQQHHARPSAVGHRVVHGGPRLRTHQRITDDVRRQLLDA
LHFAPLHIPPALELINEATQIFRDATHYACFDTAFHATLPPRAAQLPLPRRYADAGVIRY
GFHGLSYESLVKQLGAALPSRAVFAHLGNGASLCALLDGRSVDTTMGLTPTGGIPMGTRS
GDLDPGVLLYLMRAERLDADALDTLLNRQSGLAGYADGESDMQALQKSAANGDAHASLAL
DAFATGVRKTIGGYAALLGGIDLLVFTGGIGEHSAEVRRRVCDGLAFLGLVEGDPVGKVR
VLHTEEEKQIARHCRELLQAGES
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgcacgaccacgatcaggaacggacgattctggtgctgaacagtgggtcgtcgtcgctg
aagttcgggcttttcgcaccctcggccgacgacgaaacgctgctgctcgaaggcgcggcc
gagggcatcggccgcaccgacggccgactgcggatcaaggcggccgatggtcgcgtgctg
ttgcagcaggaccaaaagctcgactcgcagaccgaggcgctgcaacagctttcgcagctg
ctcgtgcaacagcatcatgcgcggccctcggcggtcgggcatcgcgtcgtgcatggcggc
ccgcgtctgcgcacgcaccagcgcatcaccgacgacgtgcgccgtcagttgctcgacgcg
ctgcacttcgcgccactgcatatcccgccggcactcgagttgatcaacgaagccacgcag
attttccgcgacgctacgcattacgcgtgcttcgacacggcgtttcacgcgacgctgccg
ccgcgcgccgcgcaactcccgctgccgcgccgttatgcggacgctggcgtgatccgctac
ggctttcacgggctgtcgtacgaatcgctggtcaagcaactcggcgcggcattgccgtcg
cgcgcggtgttcgcgcatctcggcaatggagcgagcctgtgcgcgctgctcgacggccgc
tcggtcgacacgacgatgggcctgacgccgaccggcggcatcccgatgggcacgcgcagc
ggtgacctcgatccgggcgtgctgctgtatctgatgcgcgcggaacgactcgacgccgat
gcgctggacacgctgctcaatcgccagagcggtctggccgggtacgcggacggcgaaagc
gacatgcaagcgctgcaaaaaagcgcggcgaacggcgatgcgcacgcgtcgctcgcgctc
gatgcgtttgcaaccggagtgcgcaagacgatcggcggatacgcggcactgctcggcggc
atcgatctactcgtgtttaccggcgggatcggcgagcacagcgccgaggttcggcggcgt
gtatgcgacgggcttgcgtttcttgggctcgtcgagggcgatccggtgggcaaggtgagg
gtgctgcataccgaggaggagaagcagatcgcgcggcattgccgggaactgctgcaagcc
ggcgagagctga

DBGET integrated database retrieval system