KEGG   Burkholderia sp. CCGE1002: BC1002_4181Help
Entry
BC1002_4181       CDS       T01217                                 

Definition
(GenBank) monooxygenase FAD-binding protein
  KO
K05712  3-(3-hydroxy-phenyl)propionate hydroxylase [EC:1.14.13.127]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
bge00360  Phenylalanine metabolism
bge01100  Metabolic pathways
bge01120  Microbial metabolism in diverse environments
bge01220  Degradation of aromatic compounds
Module
bge_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bge00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    BC1002_4181
Enzymes [BR:bge01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.127  3-(3-hydroxyphenyl)propanoate hydroxylase
     BC1002_4181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ADG18176
UniProt: D5WI81
Position
2:complement(1078294..1079913)
Genome map
AA seq 539 aa AA seqDB search
METYDAIISGYGPTGATLSNLLAMMGMRVAVVERDRDIYDKPRAITADHEAMRAFQAAGL
AEEVAKGTCPHPGTDFVGVDGQTIKRFYPMPAPGPLGWEPTFMFHQPTLEGVLRDGVKRF
ESVDVFLEHSLVSLHQDAEGVEINVAGPGGSNKTLRGKYLLACDGARSVVRSQIESTIYD
LAFDEWWVVVDADLHNDVDLPERCVQYCRPWRPGTYIVGPDRLRRWEIKVLPGEMPESFN
DPAHLDRVLSTFVDTGAIEVKRVAIYRFHAVVAEKWREGRVFLLGDAAHQMPPFMGQGLC
AGVRDAYNLAWKLDAVLRGKAEDALLDTYGQERRPHVQTVVETAKSFGLIIGELDEGAAR
ERDSRLGVELAAGTAQTIRQSFIPGLATGLLYRDAIGALGAGAGQLFPQPWVSSQGIGRL
RLDDLVRGNFYLVTWNIELAAVARDILGTVASLADAMVVCVGEAEQGTAGLEAEVIAVTE
ELGLVARWLTETGTVAAVVRPDGFAYGSARNQGELKDMVVLLGRALMHTRQPEAGVPVI
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggagacatacgacgcaatcatctcgggctatggcccgaccggcgcgacgctttcgaac
ctgcttgccatgatgggcatgcgtgtggcagtcgtcgagcgcgacagggatatctacgac
aagcctcgcgcgattacagccgaccacgaggcaatgcgcgcattccaggccgcaggcctc
gcggaggaagtcgcgaagggaacctgtcctcaccctggcactgattttgtcggcgtcgac
ggtcagaccatcaagcgcttctatccgatgccggcgcccggtccactaggctgggagccg
accttcatgttccatcagcccacgctcgagggtgtgctgcgagacggggtcaaacgcttc
gagtcggtcgatgtatttctcgaacattcgcttgtctcgctgcaccaggatgccgaaggt
gtagagatcaacgtcgctggaccaggcggatcgaacaagacgctgcgcggaaagtatctg
cttgcgtgcgacggcgcacgcagcgtggtgcgaagtcagatcgagtccacaatttacgac
cttgcattcgacgaatggtgggtggtggtcgatgccgatttgcacaatgatgtcgatctt
cccgagcgatgcgtgcaatattgccgtccgtggcgaccgggtacctacatcgtcggaccg
gatcgtctacgccgctgggaaatcaaagtgctgccgggcgaaatgcccgagtcgttcaac
gaccccgcgcacttggaccgggtgctctcgacctttgtcgacacgggcgccatcgaggtc
aagcgtgtcgcgatctaccgcttccatgccgtcgttgccgaaaaatggcgtgagggtcgc
gtgtttctgctcggtgatgctgcccaccagatgccgcctttcatggggcagggtttgtgt
gcgggtgtacgtgatgcttacaacctcgcctggaagctcgatgcagtgttgcgcggcaag
gctgaggatgcattgcttgatacatatgggcaggaacgccgtccgcatgtccagaccgtc
gtcgaaacggccaagtcatttggtttgatcatcggcgaactcgacgaaggggcagcgcgg
gaacgggatagccggctgggcgtggaactggcggccggtacagcgcagacaattcgtcaa
tcgttcatccccggtctggcaaccggtctgctgtatcgggatgcaatcggtgcgcttggc
gctggcgcaggccagttgttcccgcaaccatgggtgagcagccagggcatcggccgtctg
cgtctcgacgatctggtgcgtggcaacttctatctggtcacttggaacatcgagcttgcg
gcagtcgcacgagacatacttggcacggtcgcatcactcgccgatgccatggtcgtttgc
gtgggtgaggcggagcagggtacagccggtcttgaggcggaggtgattgcagtcaccgag
gagcttgggctcgtggcacgctggctcacggagacggggactgtggcagcagtggttcgt
ccggatggctttgcctatggttccgcgcgcaatcagggcgagctgaaggatatggtcgta
ctgctcggcagagcgctcatgcacacgcgccaaccggaagcaggtgtacctgtcatttga

DBGET integrated database retrieval system