KEGG   Burkholderia sp. CCGE1002: BC1002_4816Help
Entry
BC1002_4816       CDS       T01217                                 

Definition
(GenBank) Mandelate racemase/muconate lactonizing protein
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
bge00051  Fructose and mannose metabolism
bge01100  Metabolic pathways
bge01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BC1002_4816
Enzymes [BR:bge01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     BC1002_4816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N MAAL_C
Motif
Other DBs
NCBI-ProteinID: ADG18781
UniProt: D5WDH8
Position
2:1747767..1749062
Genome map
AA seq 431 aa AA seqDB search
MTTITRLSVRDIRFPTSRSLDGSDAMNAAPDYSATYVTLETDTPNLTGHGLTFTIGRGNE
ICVTAVNALTPLIVGKKLEDIAANMGGFWRAFTSDSQLRWIGPDKGAIHLATAAVVNAVW
DLWAKSVGKPVWKLLADMSPEELVRCLDFRYVTDAITPHEALAMLHRHAKTKGEREKEML
EHGYPAYTTSAGWLGYDDDKIRRLAREGVAQGWTHFKQKVGGDLEEDVRRARILREEIGE
NLKLMMDANQVWDVDEAIANMRRLAEFDPWWIEEPTSPDDILGHAAIRRRLGSIGVATGE
HCHNRVMFKQLLQAQAIDFCQIDSCRLGGLNEVIVVLLMAAKFGVPVCPHAGGVGLCEYV
QHISLFDYICVSGSLENRVLEYVDHLHEHFVDPVVIRNGHYMPPQRPGYSIEMLEGTLDK
YWYPEGAAWQE
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgatcacaaggctgtccgtacgggacatccggttccccacttcacgttcgctg
gacggctccgacgcgatgaatgccgcgccggactactccgccacctacgtcacgctcgaa
accgacacgccgaatctaaccggccacggcctcacgttcacgattggccgcggcaatgaa
atctgcgtgactgccgtgaatgcactcacgccgttgatcgtcggcaagaagctcgaagat
atcgccgcgaatatgggcggtttctggcgcgcctttacttcggatagccaactgcgctgg
atcggcccggacaaaggcgcgattcatcttgccaccgcggcggtcgtcaacgcggtgtgg
gacctgtgggcgaaatccgtcggcaagccggtctggaagctgctggccgacatgagtccg
gaagaactcgtgcgctgcctcgactttcgctatgtaaccgatgcgatcacgccgcacgaa
gcactcgcgatgctgcatcgtcatgcgaaaaccaaaggcgagcgtgaaaaggaaatgctc
gagcacggctatccggcctacaccacctcggcaggctggctcggttacgacgacgacaag
attcgccgtctcgcgcgcgaaggggtcgcgcagggatggacgcacttcaagcagaaggtc
ggcggcgacctggaagaagacgtgcggcgtgcgcgcattctgcgcgaagagatcggcgag
aacctgaagctgatgatggacgcgaaccaggtgtgggacgtcgatgaggcgatcgcaaac
atgcgtcgtctcgccgagttcgacccgtggtggatcgaggagcccaccagtcccgacgac
atcctcggtcatgcggcgattcgccggcggctcggttcgatcggcgtcgcaaccggcgag
cattgccacaatcgcgtgatgttcaagcaactgctgcaagcacaagcgatcgacttctgc
cagatcgacagttgccggctcggcggactcaacgaagtgatcgtcgtactgctgatggct
gcaaagttcggtgtaccggtgtgcccgcatgctggtggtgtcggattgtgcgagtacgtg
cagcatatttcgctgttcgactatatctgcgtgtcggggtcgctcgagaaccgggtgctc
gagtatgtcgatcatctgcacgagcatttcgtggaccccgtggtgatccgcaacgggcac
tacatgccgccgcaacggccgggctatagcatcgagatgctggaaggtacgttggacaag
tactggtatccggaaggagctgcgtggcaggaatga

DBGET integrated database retrieval system