KEGG   Paraburkholderia sp. CCGE1002: BC1002_5447
Entry
BC1002_5447       CDS       T01217                                 

Definition
(GenBank) type VI secretion system lysozyme-related protein
  KO
K11897  type VI secretion system protein ImpF
Organism
bge  Paraburkholderia sp. CCGE1002
Brite
KEGG Orthology (KO) [BR:bge00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bge02044]
    BC1002_5447
Secretion system [BR:bge02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BC1002_5447
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: ADG19375
UniProt: D5WFZ9
Position
2:2456648..2457085
AA seq 145 aa
MPAIVIGSPMPLFDRLAASGEAQLAGEDGLRASIARELTRLLNTRSRLTFDEFAESDGSV
IDYGVPDFSHRSLHSGPDRDLIAAAIGRAISLFEPRLANVEVAFAFSAAHAQRAILTISA
QMRAGQSVTHVAFELAANGHTLVAA
NT seq 438 nt   +upstreamnt  +downstreamnt
atgcccgcaatcgtaatcggttcaccgatgccattgttcgatcgcctcgccgccagcggc
gaggcgcagcttgccggcgaagacgggctgcgggcgtcgatcgcgcgtgaactcacgcga
ctgctcaatacacgctctcgtttgacgttcgacgaatttgccgaaagcgacgggagcgtg
atcgattacggcgtgcccgatttttcgcaccggtcgctgcattcgggaccggaccgtgat
ctgatagccgcagcgatcgggcgggctatttcgctgttcgagccgcgcctcgccaatgtc
gaggttgcgtttgccttctccgctgcgcacgcgcagcgggcaattctgaccatcagtgct
caaatgcgtgctggccaaagcgtcacgcacgtggcattcgagctggccgccaacggccat
acgctcgtcgcggcgtga

DBGET integrated database retrieval system