KEGG   Burkholderia sp. CCGE1002: BC1002_5652Help
Entry
BC1002_5652       CDS       T01217                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
bge00071  Fatty acid degradation
bge00072  Synthesis and degradation of ketone bodies
bge00280  Valine, leucine and isoleucine degradation
bge00310  Lysine degradation
bge00362  Benzoate degradation
bge00380  Tryptophan metabolism
bge00620  Pyruvate metabolism
bge00630  Glyoxylate and dicarboxylate metabolism
bge00640  Propanoate metabolism
bge00650  Butanoate metabolism
bge00900  Terpenoid backbone biosynthesis
bge01100  Metabolic pathways
bge01110  Biosynthesis of secondary metabolites
bge01120  Microbial metabolism in diverse environments
bge01130  Biosynthesis of antibiotics
bge01200  Carbon metabolism
bge01212  Fatty acid metabolism
bge02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BC1002_5652
   00630 Glyoxylate and dicarboxylate metabolism
    BC1002_5652
   00640 Propanoate metabolism
    BC1002_5652
   00650 Butanoate metabolism
    BC1002_5652
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BC1002_5652
   00072 Synthesis and degradation of ketone bodies
    BC1002_5652
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BC1002_5652
   00310 Lysine degradation
    BC1002_5652
   00380 Tryptophan metabolism
    BC1002_5652
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BC1002_5652
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BC1002_5652
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BC1002_5652
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bge04147]
    BC1002_5652
Enzymes [BR:bge01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BC1002_5652
Exosome [BR:bge04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BC1002_5652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ADG19561
UniProt: D5WK15
Position
3:86589..87773
Genome map
AA seq 394 aa AA seqDB search
MNTREVVIAHTVRTPIGAFGGSLKDVPATALGALVVRETLRRAALDPKSLSSVVMGNVVQ
AGNRMNPARQAAIGGGVPVSVPALTVNRVCGSGAQAVVSAAQEIALGYGEVAVAGGMESM
ERAPYLLDTARWGARMGNAQVHDSMLRDGLVDAFSGEHSGWHTEDLATKTDLTRRAQDEW
AARSQQRFAAAQERGAFDAELVAVEIEGRKGSVQFTRDEQPRPETTVETLARLRPAFRPD
GTITAGNAPGLNSGAAAMIVAERGYADTKGIEASARLAAFGIAAVEPGMFGLGPVPAVHI
ALERAGWKLADVERVEINEAFAAVPLAVARQLGLPHDIVNVEGGAIAHGHPIGATGAVLI
TRLVHSMRRDGLKRGIVTLCIGGGQGIALALEIL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaatacccgtgaagttgtcattgctcataccgttcgtacaccaattggcgcgttcggt
ggatcgttgaaggacgtccccgcgactgcgcttggcgcgctggtcgtgagggaaacgttg
cggcgcgccgcgctcgatccgaaatcgctgtcgtccgtcgtgatgggcaatgtcgtccag
gccggtaacaggatgaatccggcgcgacaggccgccatcggcggcggcgtgcccgtatcg
gtgccggcactcaccgtcaaccgcgtctgtggctcgggcgcgcaggcggtcgtctcggcg
gctcaggaaatcgcgcttggctatggtgaagtcgcggttgccggtggcatggaaagcatg
gagcgcgcgccgtatctgctggacaccgctcgctggggtgctcgcatgggtaacgcacaa
gtgcacgacagcatgctgcgcgacggtctcgtggatgcattctcgggggagcactcgggc
tggcacacggaagatctcgcgacgaagaccgacctgacgcggcgcgcccaggatgagtgg
gccgcgcgttcgcagcagcgtttcgcggccgcgcaggaacgcggcgcattcgatgccgaa
ctcgtcgccgtcgaaatagaagggcgtaaggggagcgttcagttcacgcgcgacgagcag
ccgcgcccggaaacgaccgtggaaacactggcaaggctgcgtcccgcgttccgtcctgat
ggcacgatcaccgcgggcaatgcgcccggcctgaacagcggtgcggcggcgatgatcgtg
gccgagcgcggttacgccgacacgaagggtatcgaagcgagcgcacgccttgccgctttc
ggcatcgccgctgtcgagcccggcatgttcggtctcggtcccgtgccggcggtgcatatc
gcattggagcgagcgggctggaagctcgccgacgtcgaacgcgtcgagatcaacgaggca
ttcgccgccgtgccgctcgcggttgccaggcagcttggactcccgcacgacatcgtcaat
gtcgaaggcggcgcgattgcgcatggtcatccgatcggagctacgggcgcggtcctgatc
acgcgtctcgtccattcgatgcgtcgcgatggcctgaagcgcggcatcgtcacgctgtgt
atcggtggcggtcagggtatcgcgctcgcgctggagatcctgtaa

DBGET integrated database retrieval system