KEGG   Paraburkholderia sp. CCGE1002: BC1002_6238Help
Entry
BC1002_6238       CDS       T01217                                 

Definition
(GenBank) virulence protein SciE type
  KO
K11898  type VI secretion system protein ImpE
Organism
bge  Paraburkholderia sp. CCGE1002
Brite
KEGG Orthology (KO) [BR:bge00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bge02044]
    BC1002_6238
Secretion system [BR:bge02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   BC1002_6238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImpE
Motif
Other DBs
NCBI-ProteinID: ADG20098
UniProt: D5WLK2
Position
3:695187..696023
Genome map
AA seq 278 aa AA seqDB search
MRISAAPPNPDTPTLGSLLDAQTYGELKERTIDNVRKHPSNVCERWLLFELLCLDGEWSR
ALQQLQTWATLEPEGTSRAQMYRGLIRSEMFRAEVFAGQRTPGEIEPLPEWVKTLLQANA
KLGEGNLAAADELRGAALNAAPATRGESTQIGEFEWLTDSDSRLGPVCELTVAGGYRWVP
FDSLKSLTFGPVTALTDLVWRSAVVGLRDATVLSGYLPVRYPGSETGPTATRLSRETTWK
DVGETGVIALGQKTWSTDKGDVGLLDIGECRFNYDERV
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgagaatatccgctgccccgcccaaccctgacactccaacccttggcagcctgctcgac
gcgcagacttacggcgaactgaaggagcgaaccatcgacaacgttcgcaagcatccgtcg
aacgtgtgcgagcgctggctgctgttcgagctgttgtgccttgacggcgaatggagccgc
gcgctacagcagctgcagacgtgggccacgctcgagccggaaggcacatctcgcgcccag
atgtatcgcgggctgattcgcagcgagatgttccgcgccgaggtgttcgcgggtcagcgc
acgccgggcgagatcgagccgttgcccgagtgggtgaaaacgctgctgcaagccaacgcc
aagctcggcgagggcaacctcgccgcagccgacgaactgcgcggcgccgcgttgaacgcc
gcgccggccacgcgcggcgaaagcacgcagatcggcgaattcgagtggctgaccgatagc
gacagccggctggggcccgtgtgtgagctgaccgtcgcgggcggttatcgctgggtgccg
ttcgactcgctgaaatcgctgacattcggtccggtcaccgcgctgaccgacctcgtctgg
cgctcggccgtcgtgggcctaagggacgcgaccgtgctgagcggctatctgccggtgcgc
tatcccggctccgaaactggccccactgccacccggctctcgcgcgaaaccacctggaaa
gacgttggggaaaccggcgtgatcgcgctcggccagaaaacctggagcaccgacaagggc
gacgtcggcctgctcgacatcggcgaatgccggttcaattacgacgagcgcgtatga

DBGET integrated database retrieval system