KEGG   Paraburkholderia sp. CCGE1002: BC1002_6242Help
Entry
BC1002_6242       CDS       T01217                                 

Definition
(GenBank) type VI secretion-associated protein, ImpA family
  KO
K11902  type VI secretion system protein ImpA
Organism
bge  Paraburkholderia sp. CCGE1002
Brite
KEGG Orthology (KO) [BR:bge00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bge02044]
    BC1002_6242
Secretion system [BR:bge02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BC1002_6242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImpA_N Disulph_isomer
Motif
Other DBs
NCBI-ProteinID: ADG20102
UniProt: D5WLK6
Position
3:699487..700557
Genome map
AA seq 356 aa AA seqDB search
MNANTPTVALRYADLLEPVSAPAPCGPDLEYDPAFVMLQAAAAPRAEAQYGDFVDVPPTA
NWADIERDCRALLLRTKDIRLAVILLRCRTRLDGAAGLRDGLALLMAMFECYGEALHPLP
VFEGERDAAMFANAIGGLVEPDGMLADARDIPMPRAAGLQLHLRDIEKSFATPRQKDALA
PESVARLLKELWGRRDAAIAALVEAQCLTQRIAVWCDETLGVDAPDLGALSRALQPFAQH
RVDGGGASAPTPAPAPAVNEQDNDIARGSAPSSVATATLPKSDAPADPPITAPSPMDRWS
ALAAIQETRRWFEQNEPSSPVIVLLRQSERMVGKRFSELAHIIPADLLAKWDEFDG
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccaacactcccaccgtcgcgctgcgctacgccgatctgctcgaaccggtgtcg
gcgcccgcgccttgcggtcccgatctcgaatacgacccggctttcgtgatgctgcaggcg
gccgcggctccacgcgccgaagcgcagtacggcgacttcgtcgacgtgccgccaacggcc
aattgggccgacatcgaacgcgattgccgcgcgctgctgctgcggacgaaagacatccgc
ctcgcggtgatcctgctgcggtgtcgaacccggctcgacggcgcggccggcctgcgcgat
ggcctggctttgctaatggcgatgttcgaatgctatggcgaagcgctccacccgctgccc
gtgttcgaaggcgaacgagacgcggcgatgttcgccaacgcgatcggtgggctcgtcgaa
cccgatggcatgctggccgatgcgcgcgacataccgatgccgagggcggcgggactgcaa
ctgcatttgcgcgacatcgaaaaatcattcgcgacgccgcgccagaaggacgcgctcgcc
cctgaatccgtcgcccgcttgctaaaggaattatggggccgacgcgacgcagcgattgcc
gcattagtcgaagcgcagtgtctgacgcaacgcatcgccgtatggtgcgatgagacgctc
ggcgtcgacgcgcccgatctcggcgcgttgtcccgagcgctgcagccattcgcgcagcat
agggtggacggcggcggcgcgtccgcgccaacgccagcgcccgcaccagccgtcaacgag
caggacaacgacatcgcgcgtggatcggcgccgtccagcgtcgctacggcaacgctaccg
aagtccgacgcgccggccgatccaccaatcaccgcgccctctccaatggatcgctggagc
gcgctcgcagccatacaggaaacacgcaggtggttcgagcaaaacgaaccgagcagtccc
gtcattgttttgctgcgccagtcggaacgaatggtgggcaaacggttttcagaactcgcc
catatcattcccgcggatttactcgctaaatgggatgagttcgacggttga

DBGET integrated database retrieval system