KEGG   Burkholderia sp. CCGE1002: BC1002_6248Help
Entry
BC1002_6248       CDS       T01217                                 

Definition
(GenBank) type VI secretion protein IcmF
  KO
K11891  type VI secretion system protein ImpL
Organism
bge  Burkholderia sp. CCGE1002
Pathway
bge03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bge00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BC1002_6248
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bge02044]
    BC1002_6248
Secretion system [BR:bge02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BC1002_6248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImcF-related_N IcmF-related IcmF_C cobW MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: ADG20108
UniProt: D5WLL2
Position
3:complement(709366..713331)
Genome map
AA seq 1321 aa AA seqDB search
MSYLNRLSKLVLTRQTLMLAAILVAAAAVWFVGPLIAFGDYRPLDSVLSRTLSVVVLLLL
LLFWLLGWSPGVIGVALLCVALWYFGPILAFGETHPLGTTWSRVLLISVLLACYAIYELY
RLWRAVRSDDVLLQRVLNPFTKKSAATPVARDEIRALHAIVAKAIDKLKRMRGGSAGLRR
LLESQRYLYELPWYMVVGSPGAGKTTLILNSGLDFPEAEQMAAASLGSRIETENCDWWFA
NEAVLIDTAGRYMVQDAASHDAAQVDVKPEDLKSANEAEWRGFLGLLRKRRPRAPINGAL
LAVSVEELLTRPASERKALAASMRARLGELRQQLGIRFPVYVVVTKLDLLPGFGEYFQSL
TAESRAQIFGFTLPYQEEPEQHGRDTLRLTCAAEMRELEQGLEDGINTRLQEVYEVDLRK
KLYALPAEFRSLCAELNELLALVFLDSKYDDTQLNSTLRGVYFTSAAQTHEAVSADSTTL
LQRLRRGLAGLFGAAPKTVSPSSGDATPTAYRGYFLRNLFQRVILAEAHLVRPNLYWEIR
FRALRLVGHLLAIIIVVWLMGALVVSFGNNREYLAAIDGKANGLAARVSSQRKAPRAGAM
GSILSASRDLPQFDGIDLDSPGLAWRYGLYTVPAISAAAGETYDGLLKQMLLPQVIGRLE
TVLDTQIGAQAADGVYRTLTVYLMLFDRSQYDAKAIKAWVLGDWEHNNSVAPLGERSVMA
RHLDALLGEGVPAVPAKPVNAQLVRRAREFLGRNPASGRLYERAMNAMAPEAPENVTLLS
AAGPQATTVFMLADGSTLARGIPGLYTYDGYHAVFNQRLPEFLERARKQDAWVMGEADAS
ARWRQMANGNALRKDRLADDIRRQYLTDYANYWSQFLDDVRPVSGSDGTLAPDLQTLRTL
AAPDSPLARLARTAARETSLSVADGADEPSAAGSAINVITRRSQVARAASAVAATATIGQ
LAQRKMERELVDRRFAALREVVTGQADSGSALPGGSGVLQLGGVIGLINEQYTRLMTAGD
VLATNSMPPTDDLGSTMQFEAQKLPPPFRAVLVGLASQSIRKVDRNVGSLLTMQVESSVG
AQCRRAVEGKYPFVASVQEVDIDDFNRVFAAGGLLDDFFHKTLASRVDTSIRPWRYKPVS
PGMPPMQGPSLDPFERAAAIRQTFFRDPSATRMSWNAGLKVVSLDPEITDLLIDVDGQNL
RYAHGPVATFPITWPGPRGGSMAGLTANPRVRPDTSTVMTAGPWALFRLIDRGLVTSTLS
SSRSAVDFNFDDRHAVIELTSGGQSGPQLTALLRGFRCPGSGSALARRAEASSGSASADE
L
NT seq 3966 nt NT seq  +upstreamnt  +downstreamnt
atgtcttatttgaaccgcttatcgaaacttgtgctgacgcgccagacgctgatgctcgcc
gcgatcctcgtggcggctgcggccgtctggttcgtggggcctctgatcgcatttggcgac
taccggccgctcgacagcgtgctctcgcgcacgctgtcagtcgtcgtgctgttgttgctg
ctgctgttctggctgctcggctggtcgccgggtgtcatcggcgtcgcgttgctgtgtgtc
gcgctctggtatttcggaccgatactcgcgttcggcgaaacgcatccgctcggcaccaca
tggtcccgcgtgctgctgatctcggtgctgctcgcctgctatgcaatctatgagctgtac
cgcctgtggcgggcagtgcgcagcgacgacgtgctgctgcagcgcgtcctgaatccgttc
acgaagaagtcggcagcgacccctgttgcacgagacgaaatccgcgcgcttcacgcgatc
gtcgcgaaggccatcgacaagctcaaacgcatgcgcggcgggtcggcggggctgcgtcgc
ctgctcgaaagccagcgctatctgtacgaacttccgtggtacatggtcgtgggctcgccg
ggtgcgggcaagacgacgttgatcctgaattcgggtctggattttccggaggcggagcag
atggccgcggcgtcgcttggaagccgcatcgaaacggagaattgcgactggtggttcgcg
aacgaggcggtgctgatcgataccgctggccgttatatggttcaggacgcagcatcgcat
gacgccgcgcaggtcgacgtcaaaccggaagacctgaagagcgcgaacgaggccgaatgg
cgcggctttctcgggctgcttcgcaagcggcgaccgcgcgcgccgatcaacggtgcgttg
ctggccgtttcggtcgaagagttgttgacgcgcccagcgtccgaacgaaaggcgctcgcc
gcgtcgatgcgcgcgcggcttggcgagttgcgccagcagttggggattcgattcccggtt
tacgtagtcgtcacgaagctcgatctgctgcccggcttcggggagtatttccagtcgttg
acggcggaaagtcgcgcgcagattttcggctttacactgccctatcaggaagagccggaa
caacacggccgcgacacactgcgcctgacctgcgcggccgagatgcgtgagctggagcag
ggactcgaagacggcatcaacaccaggctgcaagaggtgtacgaggtcgatctgcgcaag
aagctttatgcgctgccggccgagtttcgcagcctgtgcgcggaactcaatgaattgctc
gcgctggtgtttctcgattcgaaatacgacgacacgcagttgaacagcacattgcgcggc
gtctatttcacgagcgcggcgcagactcacgaggccgtgtccgccgacagcaccacactg
ttgcagcggctgcgccgcgggctcgcgggtttgttcggcgccgcgccgaaaaccgtctcg
ccgtcgtccggcgacgctacgcctaccgcctatcgcggctacttcttgcgcaatctgttt
cagcgcgtgatcctggccgaagcgcatctggtgcggccgaacctgtactgggaaatccgc
ttccgcgcgttgcgtctggtcgggcatctgctcgcgatcatcatcgtggtgtggctgatg
ggtgcgctggtcgtgagcttcggcaataaccgcgagtatcttgctgcgatcgacggcaag
gccaatgggctcgccgctcgggtctcgtcgcaacgcaaggcgccgcgggccggggcgatg
gggtcgatactttcagcgtcgcgtgacctgccgcagttcgacggcatcgacctcgacagt
cccggtctcgcatggcgctacgggctgtacacggtgcccgccatcagcgccgccgccggc
gagacctacgacggtctgctgaagcagatgctgctgccgcaagtcatcggccggctcgaa
acggtgctcgatacgcaaatcggcgcacaggccgcggacggcgtttatcgcacgctgacg
gtctacctgatgctgttcgatcgctcgcaatacgacgcgaaagcaatcaaggcatgggtg
ctcggcgactgggagcacaacaacagcgtcgcaccgctcggcgagcgcagcgtgatggcg
cgacacctcgacgcgctgctcggagaaggggtccccgcggtgccggcaaaaccggtgaat
gcgcagctggtgcgtcgcgcgcgcgagttccttggccgcaatccggcgtccggacggctc
tacgaacgtgcgatgaacgccatggcgccggaggcgcccgagaacgtcacgctgctgagc
gccgcgggtccgcaggccactaccgtgttcatgctggccgacggctcgacgcttgcgcga
ggcatccccggtctctatacctacgacggctatcacgcggtattcaaccagcgcctgccc
gaatttctcgagcgggcgcgcaaacaggacgcgtgggtgatgggcgaggccgatgcatcg
gcgcggtggcggcagatggccaacggcaacgcactgcgcaaggacaggctcgccgacgat
atccgtcgccagtacctgaccgactatgccaactactggagccagtttctcgacgacgtg
aggccggtgtccggcagcgacggcacgctggcgcccgatctgcagacgctgcgcacactg
gccgcgccggattcgccattggcgagactcgcgcgaacggccgcgcgcgagacgtcgctg
tcagtcgctgacggcgcggacgagccgtcggccgcggggagtgccatcaacgtgatcacc
cgtcgctcgcaggtagcgcgcgccgcgagcgccgtggcggcaaccgctaccatcggtcag
cttgcgcagcggaagatggaacgtgaactggtcgacagacgctttgccgcgctgcgcgaa
gtcgtgaccggccaggccgatagcggcagcgcgctgcctggcggcagcggcgtgctgcag
ctgggcggcgtcatcgggctgatcaacgagcagtacacgcgattgatgacggccggcgac
gtgctcgccaccaacagcatgccgcccacggacgacctcggctccacgatgcagttcgag
gcgcagaagcttccgccgccgtttcgggccgtgctcgtgggcctcgcgtcgcagtcgata
cgcaaggtggaccgcaacgtcggctcgctgctgacgatgcaggtcgaatcgagcgttggc
gcgcaatgccgccgcgctgtcgaaggcaaatatccgttcgtcgcgagcgtccaggaagtc
gacatcgacgatttcaaccgcgtgttcgcggcaggcggcctgctcgacgacttcttccac
aagacgctcgcgagccgtgtcgatacgagcatacggccgtggcgctataagccggtcagc
cccggcatgccgcccatgcagggaccgagcctcgatccgttcgagcgcgccgcggcgatc
cgccagacatttttccgcgatccgagcgcaacccggatgtcgtggaacgcgggcctgaag
gtcgtgtcgttggacccagagattaccgatctgctcatcgacgtcgacgggcaaaacctg
cgctatgcgcacgggccggtcgcgacattcccgatcacatggccggggccgcgcggtggc
tcgatggccggcctcaccgcgaatccgcgcgtgcgtccggacacgtcgaccgtgatgacc
gcaggtccgtgggcgctgttccgtctgatcgaccgggggcttgtgacgtcgacgttgtcg
tcgagccgctcggcagtggacttcaatttcgacgaccggcacgcggtgatcgaactgacg
tcgggcggacagtcgggaccgcaactgacggcgttgctgcggggttttcgttgtcctggc
agtggaagcgcgctggcaaggcgagcggaagcgtcgtcaggctccgcatccgccgacgag
ctgtag

DBGET integrated database retrieval system