KEGG   Paraburkholderia atlantica CCGE1002: BC1002_7221
Entry
BC1002_7221       CDS       T01217                                 
Name
(GenBank) type IV secretory pathway VirB4 components-like protein
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
bge  Paraburkholderia atlantica CCGE1002
Pathway
bge02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bge00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BC1002_7221
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bge02044]
    BC1002_7221
Enzymes [BR:bge01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     BC1002_7221
Secretion system [BR:bge02044]
 Type IV secretion system
  Trb secretion system protein
   BC1002_7221
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG AAA_10 AAA_22 AAA_16 T2SSE
Other DBs
NCBI-ProteinID: ADG20961
UniProt: D5WNT2
Position
pBC201:complement(453114..455576)
AA seq 820 aa
MLKKSLKRRSIQEIAPWATMVTPELILDKDGSLLTVYTFEGVDADSPNASDISAARDNLD
HACKNFDHRITAWWKLSHRRVKGDIGGTFDSSMDARVDEINRAHVASGRYFRNTHSLALA
FTPETGVNKIFEKVAYHMTVGGKSMPLAIFETIKDSVLARSAFAFDIERLTSDIKRFEGV
IDAFKGGVTRLRMKRLQLQNALAFLHQAANPSVPPRRVRYPVTMLDTHLTESEVTIGADT
LMFESAHGKRYAKIIAVKEWMGFQEAALDVLAEVDAELDVCVMFRFLDTTKASAYIEKIR
KFYKVAAFNPWSILKAYFSKEEQKNDEGRERLADEAEKALAKLVADGQQYGFANVSVIVY
GDTVEECDDATREVIGRIGNAGFGVILERDNLFAAWQTTLPGRWDQQRRLQFVETPAVSD
IAPVRSVSEGDTVNAWLTQQSGEKTGPLTMLPTRHKTLQRVSLHHPGGKSHALVIGPIGA
GKSIFLNFLVSQTGRHKARRIRFDKDRSTRIPTLLAGGRFVDATGRFEAGTSVNPLSLLH
DPKHFPYVAEWVQMAIEDDDFRCSPQQQRTIFEKVTVLGTGYPRDLWTLSNLNALLPIEL
RERLAVWTQGEKNGRFFDHIDDAFSLSDDISIEMGDLFQNYPVAAALFMDYAFYRIAQWL
DGKRYTVIEVEEAGFFFQYPRFYQRLEIWAVTIRKLNATLLLATQSLSQVARIPNFEILK
ENIPNIFYLPNKDAKNNLHLYRDLFGLTEHQIDMLANAVPNRDYLWVTPDQTRMLQASFP
KETLAVLRSDGRAQAVLDRHYTSGAPDWREAYVREMLTLD
NT seq 2463 nt   +upstreamnt  +downstreamnt
atgctgaagaagagcctgaagcgccgctcgatccaggaaatcgccccgtgggcgacgatg
gtcacgcccgaactgatcctcgacaaggacgggtcgctgctgaccgtctatacgtttgaa
ggcgtggacgcggacagcccgaacgcctccgatatttcggccgcgcgcgacaacctggat
catgcctgcaagaatttcgaccaccggatcacggcgtggtggaagctctcgcaccgccgc
gtcaagggagacatcggtgggacattcgattcctcgatggacgcgcgtgtcgacgaaatc
aaccgcgctcatgtcgcgagcggccggtatttccgcaacacgcattcgctcgcactcgcc
ttcacgcccgagaccggcgtcaacaagatcttcgagaaggtcgcgtatcacatgacggtg
ggcggcaaatcgatgccgctcgcgatcttcgagacgatcaaggactcggtgcttgcgcgc
agtgccttcgccttcgacattgagcggctcacgtctgacatcaagcggttcgaaggcgtg
atcgatgcgttcaagggcggtgtcacgcgcctgaggatgaagcggctgcagttgcagaac
gcgctcgcgttcctccatcaggcggccaacccgtcggtgccgccgcggcgcgtgcggtat
cccgtcacgatgctcgatacgcacctgaccgagagcgaagtcacgatcggtgccgacacg
ctgatgttcgaatcggcgcacggcaaacggtacgcgaagatcatcgcggtcaaggagtgg
atgggctttcaggaagccgcactggacgtgctcgccgaagtcgacgccgaactggatgtg
tgcgtgatgttccgctttctggacacaacgaaggcgagcgcgtacatcgagaaaatccgc
aagttttacaaggtcgcagcgttcaacccctggtcaatcctcaaggcctatttctcgaag
gaggagcagaaaaacgacgaaggccgcgagcgtctcgctgatgaagcggaaaaggcgctg
gcgaagctcgttgcggacgggcagcagtatggctttgcgaacgtttcggtgatcgtctat
ggcgataccgtcgaggaatgcgacgacgccacgcgcgaagtgatcggccgcatcggcaac
gcaggctttggcgtgatcctcgagcgggacaatctgtttgccgcctggcagacgacactg
ccgggccggtgggaccagcagaggcgattgcagtttgtcgaaacgccggccgtgtccgat
atcgccccggtgcgcagcgtatcggagggcgacacggtcaatgcgtggctcacgcagcag
tccggtgagaagaccgggccgctcacgatgctgccgacgcgtcacaagacgctgcagcgc
gtgagtctgcaccatccgggcggcaagtcgcacgcgctcgtgattggcccgattggcgcg
ggcaagtcgatcttcctgaatttcctggtctcccagaccgggcgccacaaggcgcggcga
atccggttcgacaaggaccgctcgacccgcatcccgacccttctcgcgggcggccgtttc
gtcgacgcgacggggcgctttgaggccggaacgtcggtcaatccgctctcgctgctgcac
gatccgaagcacttcccgtacgtcgccgagtgggtgcagatggcgatcgaggacgatgac
ttcagatgctcgccgcaacagcagcgcacgatctttgagaaggtcaccgtcctgggaacg
ggctacccgcgcgacctctggacattgtccaacctgaacgcgcttctgccgatcgagctg
cgcgagcggctcgccgtctggacccagggcgaaaagaacggccggtttttcgaccacatc
gacgacgccttctcgctgtccgacgacatctcgatcgaaatgggcgatctgttccagaac
tatccggtggccgcggcgctgttcatggattacgcgttctaccgtatcgcgcagtggctc
gatggcaagcgctatacggtcatcgaagttgaggaggccggcttcttcttccagtatccg
cgcttctatcagcggctggagatctgggcggtcacgatccggaagctgaatgcgacgcta
ttgctcgcgacgcagtcgctttcccaggtggcgcggattccgaacttcgaaattctcaag
gaaaacattccgaacattttctatctgcccaataaggatgcgaagaacaacctgcatctg
tatcgcgacctgttcgggctgacggaacaccagatcgacatgctggccaacgccgtgccg
aaccgcgattacctgtgggtgacgccggaccagacccgcatgctgcaggcgagcttcccg
aaggaaacgctcgcggtgctccgctcggacggccgcgcgcaggcggtgctcgacaggcac
tacacgtccggcgcaccggactggcgcgaggcctacgtgcgcgaaatgctgactctcgac
tag

DBGET integrated database retrieval system