KEGG   Burkholderia sp. CCGE1003: BC1003_0223Help
Entry
BC1003_0223       CDS       T01314                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
bgf00071  Fatty acid degradation
bgf00280  Valine, leucine and isoleucine degradation
bgf00281  Geraniol degradation
bgf00310  Lysine degradation
bgf00360  Phenylalanine metabolism
bgf00362  Benzoate degradation
bgf00380  Tryptophan metabolism
bgf00410  beta-Alanine metabolism
bgf00627  Aminobenzoate degradation
bgf00640  Propanoate metabolism
bgf00650  Butanoate metabolism
bgf00903  Limonene and pinene degradation
bgf00930  Caprolactam degradation
bgf01100  Metabolic pathways
bgf01110  Biosynthesis of secondary metabolites
bgf01120  Microbial metabolism in diverse environments
bgf01130  Biosynthesis of antibiotics
bgf01212  Fatty acid metabolism
Module
bgf_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bgf00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BC1003_0223
   00650 Butanoate metabolism
    BC1003_0223
  Lipid metabolism
   00071 Fatty acid degradation
    BC1003_0223
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BC1003_0223
   00310 Lysine degradation
    BC1003_0223
   00360 Phenylalanine metabolism
    BC1003_0223
   00380 Tryptophan metabolism
    BC1003_0223
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BC1003_0223
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BC1003_0223
   00281 Geraniol degradation
    BC1003_0223
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BC1003_0223
   00627 Aminobenzoate degradation
    BC1003_0223
   00930 Caprolactam degradation
    BC1003_0223
Enzymes [BR:bgf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BC1003_0223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ADN56227
UniProt: E1T5V0
Position
1:253208..254059
Genome map
AA seq 283 aa AA seqDB search
MSQQPHSNDAFYAHYRSLQLHRRPHGVLEVVMSGEGANKSALATADARMHYELAEIWRDI
DRDPETRVAVIRGEGKGFSAGGDLQLVEDMATDFDVRARVWREARDLVYNVINCSKPIVS
AMHGPAVGAGLVAGLLADISIAAKTARIIDGHTRLGVAAGDHAAIVWPLLCGMAKAKYYL
MLCEPVSGAEAERIGLVSLAVDESDLLPKAFEVAQKLAQGSQTAIRWTKYALNNWLRSAG
PAFDTSLALEFMGFAGPDVREGVNSLRERRAPDFGGADPWRAR
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagcaacctcacagtaacgacgccttttacgcacattaccgctcgcttcagttg
catcgtcggccacacggcgtgctcgaagtggtaatgagcggcgaaggcgcgaacaaaagc
gccctcgccaccgcggatgcgcgcatgcattacgaactcgccgaaatctggcgcgacatc
gaccgcgatcccgagacgcgcgtcgcggtcattcgcggcgagggtaagggtttttctgcc
ggcggcgatctgcaactggtcgaagacatggcgaccgatttcgacgtgcgcgcccgcgta
tggcgcgaggctcgcgatctggtctacaacgtgatcaactgcagcaagccgatcgtctcg
gcgatgcacggtcctgctgtgggcgccgggctcgtcgcggggctgctcgcggacatttcg
atcgcagcgaagacggcgcgcatcatcgacggtcatacgcggctcggcgtcgcggcgggc
gaccatgcggcaatcgtgtggccgctcctgtgcggcatggcgaaagccaagtactacctc
atgctgtgcgaaccggtgagcggtgcggaggctgagcgcatcgggctcgtgtcgcttgcc
gtcgacgaaagcgatctgctgccgaaggcattcgaggtcgcgcaaaagctggcgcaaggc
tcacaaacggcgattcgctggaccaagtacgcgctgaacaactggctgcgctcagccggc
ccggctttcgatacgtcgctggcgctggaattcatgggctttgccggacccgacgtgcgc
gaaggcgtgaattctttgcgcgagcggcgcgcgccggactttggcggcgccgatccgtgg
cgcgcacggtga

DBGET integrated database retrieval system