KEGG   Burkholderia sp. CCGE1003: BC1003_0512
Entry
BC1003_0512       CDS       T01314                                 

Definition
(GenBank) type VI secretion system effector, Hcp1 family
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
bgf03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bgf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BC1003_0512
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bgf02044]
    BC1003_0512
Secretion system [BR:bgf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BC1003_0512
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ADN56515
UniProt: E1T8C4
Position
1:complement(573308..573793)
AA seq 161 aa
MAIPAYMWIKDDGGADIKGSVTVQGREGSVEVVALQHGVSIPTDSNTGKLTGTRVHLPIT
FTKETDASSPYLYKAVTSGQTLKSIEIKWYKIDDAGKEKEYFNTKLDNVKVVAVNPKMHD
IKNPEFEKHNHLEDVQLRYEKITWSYKDGNIIHTDTWNERS
NT seq 486 nt   +upstreamnt  +downstreamnt
atggcaattccggcatacatgtggatcaaggacgatggcggcgccgacatcaagggttcg
gtcaccgttcagggtcgcgaaggcagcgtcgaagtggtggcgcttcagcatggcgtcagt
attccgaccgattcgaacaccggcaaactgaccggcacgcgcgttcacctgccgatcacc
ttcacgaaggagacggacgcctcgtcgccgtatctgtacaaggccgtcaccagcggtcag
acgctcaagtcgatcgagatcaagtggtacaagatcgacgacgcgggcaaagagaaagag
tatttcaacaccaagctcgacaacgtgaaggtcgtggcggtgaacccgaagatgcacgac
atcaagaaccccgagttcgaaaagcacaatcatctcgaagacgtgcaactgcgctacgag
aagatcacgtggtcgtacaaggacggcaacatcatccacaccgacacctggaacgaacgc
tcctga

DBGET integrated database retrieval system