KEGG   Burkholderia sp. CCGE1003: BC1003_0884Help
Entry
BC1003_0884       CDS       T01314                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
bgf00010  Glycolysis / Gluconeogenesis
bgf00052  Galactose metabolism
bgf00500  Starch and sucrose metabolism
bgf00520  Amino sugar and nucleotide sugar metabolism
bgf00521  Streptomycin biosynthesis
bgf01100  Metabolic pathways
bgf01110  Biosynthesis of secondary metabolites
bgf01120  Microbial metabolism in diverse environments
bgf01130  Biosynthesis of antibiotics
bgf01200  Carbon metabolism
Module
bgf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bgf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC1003_0884
   00052 Galactose metabolism
    BC1003_0884
   00500 Starch and sucrose metabolism
    BC1003_0884
   00520 Amino sugar and nucleotide sugar metabolism
    BC1003_0884
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BC1003_0884
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BC1003_0884
Enzymes [BR:bgf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BC1003_0884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase HTH_6 SIS SIS_2 ROK LacI
Motif
Other DBs
NCBI-ProteinID: ADN56868
UniProt: E1TB13
Position
1:complement(1003567..1005483)
Genome map
AA seq 638 aa AA seqDB search
MSTGVQTKAVPGAGQHADGPRLLADIGGTNARFALETGPGEIGSVQVYPCADYPGVADVI
KKYLKDTKIGRVNHAAIAIANPVDGDQVSMTNHDWTFSIEATRRALGFDTLLVVNDFTAL
AMALPGLTDSQRVQVGGGTRRPNSVIGLLGPGTGMGVSGLIPADDRWIALGSEGGHATFA
PADEREDIVLQYARKKWSHVSFERVAAGPGIEVIYRALAGRDKKRVAATVDTREIVKRAL
DGEPLAAESVDVFCGILGTFAGNIAVTLGALGGIYIGGGVVPRLGEFFARSSFRKRFEAK
GRFEAYLQNVPTYVITAEYPAFLGVSAILAEQLSNRAGGSSSAVFERIRQMRDALTPAER
RVADLALNHPRSIINDPIVDIARKADVSQPTVIRFCRSLGCQGLSDFKLKLATGLTGTIP
VSHSQVHLGDTATDFGAKVLDNTVSAILQLREHLNFEHVERAIDLLNGARRIEFYGLGNS
NIVAQDAHYKFFRFGIPTIAYGDLYMQAASAALLGKGDVIVAVSKSGRAPELLRVLDVAM
QAGAKVIAITSSNTPLAKRATVALETDHIEIRESQLSMISRILHLVMIDILAVGVAIRRA
APSADVAETVAKARQGADDDASAVLDWLSHGAASSARD
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgtctactggtgtgcaaactaaggctgttccgggcgcgggccagcacgccgacggaccg
aggctgctcgccgacatcggcggcacgaatgcgcgcttcgcgctcgaaaccggaccgggc
gagatcggctcggtgcaggtctacccttgtgcggattatcccggcgttgcggacgtcatc
aagaagtatctgaaggacacgaagattggccgcgtcaaccacgcggcaattgcgattgcg
aacccggtcgacggcgaccaggtcagcatgacgaatcacgactggacgttttctatcgaa
gccacgcgccgcgcgctcggcttcgacacgctgctcgtcgtgaacgacttcaccgcgctt
gcgatggccctgccgggcctgaccgactcgcagcgcgtgcaggtcggcggcggcacgcgc
cggccgaacagcgtgatcggcctgctcggccccggcaccggcatgggcgtatccggcctg
attccggcggacgaccgctggatcgcgctcggcagcgaaggcggccatgcgaccttcgcg
ccggccgacgaacgcgaggacatcgtgctgcagtacgcgcgcaagaagtggtcgcacgtg
tcgttcgaacgtgtggccgcgggccccggcatcgaagtgatctaccgcgcgcttgcgggc
cgcgacaagaaacgcgtggccgccaccgtcgacacgcgcgaaatcgtcaagcgtgcgctc
gatggcgagccgctcgcggccgaatccgtcgacgtgttctgcggcattctcggcaccttc
gccggcaatatcgcggtgacgctcggtgcgcttggcggcatttatatcggcggcggcgtc
gtgccgcggctcggcgagttcttcgcacgctcgtcgtttcgcaagcgcttcgaggcgaag
ggccgcttcgaggcgtacctgcagaacgtgccgacctacgtgattaccgcggaatatccg
gcttttctgggcgtatccgcgattcttgcagagcaattgtcgaatcgcgcgggcggcagt
tcgtcggcggtattcgagcggatccgtcagatgcgcgacgcgttgacgccggccgagcgc
cgcgtcgccgatctcgcgctgaatcatccgcgctccatcatcaacgacccgattgtcgac
atcgcacgcaaggccgacgtgagtcagccgaccgtgatccgcttttgccgctcgctcggc
tgccagggcttgtcggacttcaagctgaagctcgccaccggtttgaccggcacgattccg
gtcagccatagccaggtgcacctcggcgacacggcgacggatttcggcgcgaaggtgctg
gacaacactgtctcggccatcctgcagttgcgcgagcacctgaacttcgaacacgtggag
cgcgccatcgacctgttgaacggcgcgcgtcgcatcgagttctacgggctcggcaattcg
aatatcgtcgcccaggacgcgcactacaagttctttcgcttcggcattccgaccattgcg
tacggcgatctctacatgcaggccgcctcggctgcgttgctcggcaagggcgatgtgatc
gtggccgtgtccaagtccggccgcgcgcccgaactgctgcgcgtgctggacgtcgcgatg
caagccggtgcaaaggtcatcgcgatcacgtcgagcaatacgcctttggccaagcgcgcc
acggtcgcgctggaaacggatcacatcgagattcgcgagtcgcagctctcgatgatttcg
cgcatcctgcatctggtgatgatcgacattctcgcggtaggcgtggcgattcgtcgcgcg
gcgccgagcgcggatgtcgcggagacggtcgccaaagcacgtcaaggcgccgacgacgac
gcgagcgccgtgctcgactggctcagtcacggcgcggcttcatcggcgcgcgactga

DBGET integrated database retrieval system