KEGG   Burkholderia sp. CCGE1003: BC1003_0976Help
Entry
BC1003_0976       CDS       T01314                                 

Definition
(GenBank) type VI secretion system lysozyme-related protein
  KO
K11905  type VI secretion system protein
Organism
bgf  Burkholderia sp. CCGE1003
Brite
KEGG Orthology (KO) [BR:bgf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bgf02044]
    BC1003_0976
Secretion system [BR:bgf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BC1003_0976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GPW_gp25
Motif
Other DBs
NCBI-ProteinID: ADN56959
UniProt: E1TC39
Position
1:complement(1107096..1107527)
Genome map
AA seq 143 aa AA seqDB search
MPAGPSLYDMLLGQIDGEPLANHDDKTLEILSVQANIRRILNTRAGALKHVPDYGLPDLT
EIYRNLPASVHDLRNQMENTLLKFEPRLRAVEIEIDQKPDPGLLVSFIMICHLRRSGLVR
FGTHFEPPGRMHVRRLVNSDHNR
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcaggaccgtccctttatgacatgctgctcggtcagatcgatggtgagccgctc
gcgaaccatgacgacaaaacacttgaaatcctgagcgtccaggccaacatccggcgcatc
ctcaacacgcgtgccggcgcgctcaagcacgtccctgactatggactgcccgacctcacc
gagatataccggaatctgcccgcatcggttcacgatctgcgcaaccagatggagaacaca
ctactcaaattcgagccgcgcctacgtgcggtcgagatcgagattgaccagaagcccgat
cccggtctgctggtgagcttcatcatgatctgccatctccgccgatcagggctggtccgt
tttgggacgcattttgaaccgccaggccgcatgcacgtcaggcgtctcgtgaactccgac
cacaaccgttaa

DBGET integrated database retrieval system