KEGG   Burkholderia sp. CCGE1003: BC1003_0983Help
Entry
BC1003_0983       CDS       T01314                                 

Definition
(GenBank) type VI secretion protein, VC_A0111 family
  KO
K11895  type VI secretion system protein ImpH
Organism
bgf  Burkholderia sp. CCGE1003
Brite
KEGG Orthology (KO) [BR:bgf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bgf02044]
    BC1003_0983
Secretion system [BR:bgf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BC1003_0983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssG
Motif
Other DBs
NCBI-ProteinID: ADN56963
UniProt: E1TC43
Position
1:1114719..1115840
Genome map
AA seq 373 aa AA seqDB search
MKPHDLHNVEPLVASLLARAPWMSFMQLCRLLELRAPERPGFGTRDTPGHEPVRFGSWPR
VGFPAGEIATVEFGDPSDPCGPHAPPIVRTTFMGLYGVDAAVPPHMIDDIALREEGHERV
EAFLDRFNHRLVTLLYRAWKKYRYAESFRPGGSDTHSRNLLCLVGFGWGSKPERAGVPDC
RMLALLGLLSLKTRTAEGLAGVIALAVPGVDVRVDEFFPAMTGTGQPRPLTSHHAATPSG
ERVKKGLGGGYVLGRRLAYRSRAVRVTLRPENARHARDLLPGAWLHRELMAFVRLYVGVK
ADVHLRMEVSSRLAPFPAIGSAPVGPAPRLGWTTVLPADEERLITIPLGVCEAFASPPPN
PYLSPQPAYPGNR
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgcacgatcttcacaacgtcgagccgctcgttgcatccctgcttgcgcgcgcg
ccgtggatgagcttcatgcaactgtgccgcctccttgagctgcgcgcgcctgagcgtccg
ggatttggcacgcgtgatacgcccgggcacgagcctgtgcgtttcgggtcgtggccccgc
gtcgggtttccggcgggtgagatcgccacggtggagttcggtgatccatcggacccttgc
gggccgcacgcgccaccgatcgtgcgtacgaccttcatgggtctgtacggcgtcgatgcg
gcggtaccgccgcacatgatcgacgacatcgccctgcgtgaagaagggcatgaacgggtc
gaagcctttctcgaccgcttcaatcatcgcctcgttacgctgctgtaccgggcctggaaa
aaataccgctacgcggagagcttccgcccgggaggcagcgatacgcattcgcgcaacctg
ctgtgtctcgtcgggtttggctggggcagcaaacctgagcgcgccggggtgcccgattgc
cggatgctcgcgctgctgggcctgctgagcctgaagacccggacggcggaaggtctggcg
ggtgtgatcgcgctggcggtgccgggcgtcgatgtgcgcgtcgacgaatttttccctgcg
atgacgggtaccggtcagccgcggccgctcacttcgcatcacgcagccacgccgtcggga
gaacgggtgaagaaggggttggggggcggttatgtgctgggccggcgccttgcctatcgc
agtcgcgccgtgcgggtcacgctgcgccccgagaacgcgcggcatgcgcgcgacctgctg
cccggggcgtggctgcatcgcgaactaatggcgttcgtacggctatacgtcggagtcaag
gctgacgttcatcttcgcatggaggtgtcgtcacgcctcgccccgtttccagcgatcggg
agtgcaccggtgggccctgcaccgcgactcggatggacgaccgtgctgcccgccgatgag
gaacggctgattaccatcccgcttggtgtatgtgaggccttcgcgtcaccgccgcccaat
ccatatctgagcccacaacccgcatatccggggaaccgttga

DBGET integrated database retrieval system