KEGG   Burkholderia sp. CCGE1003: BC1003_1562Help
Entry
BC1003_1562       CDS       T01314                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
bgf00071  Fatty acid degradation
bgf00072  Synthesis and degradation of ketone bodies
bgf00280  Valine, leucine and isoleucine degradation
bgf00310  Lysine degradation
bgf00362  Benzoate degradation
bgf00380  Tryptophan metabolism
bgf00620  Pyruvate metabolism
bgf00630  Glyoxylate and dicarboxylate metabolism
bgf00640  Propanoate metabolism
bgf00650  Butanoate metabolism
bgf00900  Terpenoid backbone biosynthesis
bgf01100  Metabolic pathways
bgf01110  Biosynthesis of secondary metabolites
bgf01120  Microbial metabolism in diverse environments
bgf01130  Biosynthesis of antibiotics
bgf01200  Carbon metabolism
bgf01212  Fatty acid metabolism
bgf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bgf00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BC1003_1562
   00630 Glyoxylate and dicarboxylate metabolism
    BC1003_1562
   00640 Propanoate metabolism
    BC1003_1562
   00650 Butanoate metabolism
    BC1003_1562
  Lipid metabolism
   00071 Fatty acid degradation
    BC1003_1562
   00072 Synthesis and degradation of ketone bodies
    BC1003_1562
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BC1003_1562
   00310 Lysine degradation
    BC1003_1562
   00380 Tryptophan metabolism
    BC1003_1562
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BC1003_1562
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BC1003_1562
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BC1003_1562
Enzymes [BR:bgf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BC1003_1562
Exosome [BR:bgf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BC1003_1562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Alk_phosphatase
Motif
Other DBs
NCBI-ProteinID: ADN57532
UniProt: E1T7A2
Position
1:1789523..1790707
Genome map
AA seq 394 aa AA seqDB search
MQRDVVVVSGVRTAIGGFGGSLKDFAPTELGARVVREVLSRAKVAGDEVGHVVFGNVVHT
EPKDMYLARVAAINGGVAQHTPALTVNRLCGSGLQAIVSAAQSILLGDADIAIGGGAENM
SRAPYSMPAARFGQRMGDARLVDMMVGALNDPFQSIHMGVTAENVARKYEISREAQDALA
LESHRRAAQAIANGYFKEQILPITIASKKGEVVFDTDEHPRLNATAEDFSKLKPVFAKEN
GTVTAGNASGINDAAAAVVLMERGVAEQRGIQPLARLVSYAHAGVDPAYMGIGPVPASRK
ALERAGLTVADLDVIEANEAFAAQACAVSKELGFDPTKVNPNGSGISLGHPIGATGALIT
VKALYELQRVGGRYALVTMCIGGGQGIAAIFERI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgcgacgtagtggtggtaagcggtgtacgtacggcaatcggcggtttcggcggg
agtctgaaggattttgcaccgaccgagctgggcgctcgggtcgtgcgcgaggtgctctcg
cgcgccaaggtagccggcgacgaagtcggtcacgtggtgttcggcaacgtcgtgcataca
gagccgaaggacatgtatctggcacgcgtcgccgcaatcaacggcggcgtcgcgcagcac
acgcccgcgctcacggtgaatcgcctgtgcgggtctggcctgcaggccatcgtgtcggct
gcgcagagcattctgctcggcgacgcggacattgcgatcggcggcggtgccgaaaacatg
agccgcgcgccttactcgatgcccgctgcgcgcttcggtcaacgcatgggcgacgcgcgc
ctcgtcgacatgatggtcggcgcgctgaacgatccgttccagtcgatccacatgggcgtc
acggcggaaaacgtcgcgcgcaagtacgagatttcgcgcgaagcgcaggacgcgctcgcg
ctcgaatcgcatcgccgcgcggctcaggccatcgcgaacggctacttcaaggaacagatc
ctgccgatcacgattgcgtcgaaaaagggcgaagtcgttttcgacacggacgagcatccg
cgcctgaacgccacggcggaagatttttcgaagctcaagcccgtgttcgcaaaggaaaac
ggcacggtaacagccggcaacgcatcgggcatcaacgacgcggcggcggctgtcgtgctg
atggagcgcggcgtggccgaacagcgcggcatccagccgctcgcgcggctcgtgtcctac
gcgcatgctggcgtcgatccggcgtacatgggcatcggcccggtgccggcgagccgcaag
gcgctcgaacgcgccggactgacggtcgccgacctcgacgtgatcgaggccaacgaagcg
tttgccgcacaagcctgcgctgtcagcaaggaactcggctttgacccgaccaaggtcaac
ccgaacggctcgggcatttcgctcggccatccaatcggcgcgacgggcgcattgatcacc
gtgaaggcgctgtatgagctgcagcgcgtcggcgggcgctatgcgctcgtcacgatgtgc
atcggcggcgggcagggcattgcggcgatcttcgagcggatctga

DBGET integrated database retrieval system