KEGG   Burkholderia sp. CCGE1003: BC1003_1689Help
Entry
BC1003_1689       CDS       T01314                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
bgf00620  Pyruvate metabolism
bgf00630  Glyoxylate and dicarboxylate metabolism
bgf01100  Metabolic pathways
bgf01110  Biosynthesis of secondary metabolites
bgf01120  Microbial metabolism in diverse environments
bgf01200  Carbon metabolism
Module
bgf_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bgf00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BC1003_1689
   00630 Glyoxylate and dicarboxylate metabolism
    BC1003_1689
Enzymes [BR:bgf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BC1003_1689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ADN57657
UniProt: E1T829
Position
1:complement(1942741..1944912)
Genome map
AA seq 723 aa AA seqDB search
MTQMNPRGGLQVAVNLEQFVETEALPGTGIDSAAFWSGFDALVHELAPRNRALLAERDRL
QTELDNWHRANPGPVRDLRAYRAFLEGIGYIVPAPSNVKATTANVDTEIAEQAGPQLVVP
LSNPRYALNAANARWGSLYDALYGTDAIPEANGADRQKTFNPVRGAAVIAYARKFLDEAA
PLANGSHADATGYSVKDGKLVVALKSGTSELKTPAQFIGYQGEAGAPSAVLLKHNGLHFE
IQIDANDPIGKTDAAHVKDVLLEAAVSTIIDCEDSVAAVDANDKVQLYRNWLGLMNGDLS
EEVAKNGKTFTRRLNADRQYVGADGKTPVTLHGRSLLFVRNVGHLMTNPAVLTKDGAEIP
EGILDAVITTLCALHDRSNKLNSRTGSIYIVKPKMHGPAEVAFASELFARVEDLLKLPRN
TIKMGIMDEERRTSVNLLACIAEASERVAFINTGFLDRTGDEMHTAMEAGPMMRKGDMKS
STWIAAYERSNVLVGLHAGLRGRSQIGKGMWAMPDLMHAMLEQKIVHPKAGANTAWVPSP
TAATLHALHYHQVDVQAVQQELERTDYAEVRDELLDGLLTIPVVETAKWSADEIRAELDN
NAQGILGYVVRWIDQGVGCSKVPDIHDVGLMEDRATLRISSQHIANWLYHGVVTREQVEE
TFRRMAKVVDQQNAADPLYKPMAPNFDTVAFKAAQALVFEGRQQPSGYTEPLLHKFRLEV
KKG
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgactcagatgaacccgcgcggcggcctgcaggtcgccgtcaatctcgaacagttcgtc
gaaacggaagccctgcccggcaccggaatcgacagcgccgcattctggtccggtttcgac
gccctcgtgcacgagctggcgccgagaaaccgcgcgctactcgcagagcgcgaccgcctg
caaacggaactggacaactggcatcgcgccaaccccgggccggtgcgcgacttgcgcgcc
tatcgtgcgtttctggagggcatcggctatatcgtgcccgcaccgtcgaacgtgaaggcc
accactgcgaacgtcgacactgaaattgccgaacaggcgggccctcaactcgtggtgccg
ctgtcgaatccacgctatgcgctgaatgcggcgaacgcgcgttggggcagcctctacgat
gcgctctacggcaccgacgcgattcccgaggccaacggcgccgaccggcagaaaaccttc
aacccggtacgcggcgcagcggtgatcgcctacgcccgcaaatttctcgacgaagccgcg
ccgcttgcgaacggctcgcatgcggacgcaaccggttacagcgtaaaagacggcaagctc
gtcgtcgcgctgaaaagcggcaccagcgagctgaagacgcccgcgcagttcatcggctat
caaggcgaggccggcgcgccctcggccgtgctgctcaagcacaacggcctgcatttcgaa
atccagatcgatgcaaacgatccgatcggcaagaccgacgccgcgcacgtgaaggacgtg
ctgctggaagcggcggtaagcaccattatcgactgcgaagattcggtggcggccgtggac
gccaacgacaaggtccagctctatcgcaactggctcggcctgatgaacggcgatctgagc
gaagaggtcgcgaaaaacggcaagacattcacgcggcgcctgaatgccgatcgccaatat
gtcggcgcggacggtaaaacgccggtcacgctgcacggccgctcgctgctgttcgtgcgc
aacgtcggtcacctgatgaccaatccggcggtgctgacgaaagacggcgcggagattccc
gaaggcattctcgatgcggtgatcaccacgctgtgcgcgctgcacgatcgcagcaacaag
ctgaactcgcgtaccggctccatctacatcgtcaagccgaaaatgcatggtccggctgaa
gtggcgttcgcaagcgagttgttcgcgcgtgtcgaagatctgctgaagctgccgcgcaac
acgatcaagatgggcatcatggacgaggagcgccgcacgagcgtgaatctgcttgcgtgt
attgccgaggcgtcggagcgtgtggcgttcatcaacacgggttttctcgaccggaccggc
gacgagatgcacaccgcaatggaagcgggcccgatgatgcgcaagggcgacatgaagtcg
agtacgtggattgccgcgtacgagcgcagcaacgtgctcgtcggtttgcatgcgggcctg
cgcggccgctcccagatcggcaagggcatgtgggccatgcccgatctgatgcatgcaatg
ctcgaacagaaaatcgtacaccccaaggccggtgcgaacaccgcgtgggtgccctcgccg
accgctgcgacgctgcacgcgctgcactatcaccaggtcgacgtgcaagcggttcagcag
gagctggagcgcaccgattatgcagaggtgcgcgacgaactgctggacggtctgctgacg
attcctgtggtcgaaaccgcaaagtggagcgccgacgaaattcgcgccgaactggacaac
aacgcacagggcattctcggctatgtggtgcgctggatcgaccagggcgtgggttgctcg
aaggtgcccgacattcacgacgtgggcctgatggaagaccgcgcgacgctgcgtatttcg
agccagcacatcgccaactggctgtatcacggcgtggtgacgcgcgagcaggtcgaagag
actttcaggcgcatggcgaaggtggtggatcagcagaatgccgccgatccgttgtacaag
ccaatggctccgaacttcgacacggttgcattcaaggccgcgcaggcgctggtattcgaa
ggccgtcagcagccgagcggctacacggaaccgttgctgcacaagttccgcctcgaagtg
aaaaagggctga

DBGET integrated database retrieval system