KEGG   Burkholderia sp. CCGE1003: BC1003_2096Help
Entry
BC1003_2096       CDS       T01314                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding domain protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
bgf00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bgf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BC1003_2096
Enzymes [BR:bgf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BC1003_2096
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BC1003_2096
    1.1.1.-  
     BC1003_2096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 FAD_binding_3 Semialdhyde_dh AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: ADN58057
UniProt: E1TBQ9
Position
1:complement(2429796..2430863)
Genome map
AA seq 355 aa AA seqDB search
MKAARFYDRGDIRIEDIPEPVVEPGTVGIDVAWCGICGTDLHEFMEGPIFIPPCGHPHPI
SGESAPITMGHEFSGVVYAVGEGVTDIQVGQHVVVEPYIVADDVPTGPGENYHLSKNMNF
IGLGGRGGGLAEKIAVKRRWVHPVSSAIPLDQAALIEPLSVGHHAYTRSGAKAGDVALVG
GAGPIGLLLSAILKAKGLRVIVTELSAKRKEKARESGVADHILDPSEVDVAAEVMKITSG
KGVDVAFECSSVNKVLDTLVAATKPTGVVVIVSIWSHPATVNVHSVVMKELDMRGTIAYC
NDHQETIKLVEEGKIDLAPFITQRIQLDELIRKGFDTLIHNNESAVKIIVQPRLK
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcacgtttttatgatcgcggggacattcgcatcgaagacattcccgaaccc
gttgtcgagccgggcaccgtcggcatcgacgtggcatggtgcggcatctgcggcacggac
ctgcatgaattcatggaggggccgattttcattccgccatgcggccatccgcatccgatc
tccggagagtccgctccgatcaccatgggccatgagttctcgggcgtggtgtatgcggtg
ggcgaaggcgtgaccgatatacaagtcggccagcatgtggtggtcgagccttacatcgtg
gccgacgacgtgcccacggggccgggcgaaaactatcacctgtcgaagaacatgaatttc
atcggtctgggcgggcgcggcggcggcctggccgaaaagattgccgtcaagcgtcgctgg
gtgcatccggtttcaagcgccatcccgctggatcaggccgcgctgatcgagccgctgtcg
gtcggccaccatgcgtacacccgcagcggcgcgaaggcgggggatgtggctctcgtcggc
ggcgcgggtccgattggcctcttgctgtcggccattctcaaagccaagggtctgcgtgtg
atcgtgacggaactgagcgcgaagcgtaaggaaaaagcccgcgaatccggcgtggccgat
cacatcctcgacccgtccgaagtggacgtggccgcggaagtaatgaagatcaccagcggc
aagggcgtcgacgtggcgttcgaatgctcgagcgtgaacaaggttctggacacgctggtg
gccgctaccaaaccaaccggcgtggtggtgatcgtgtccatctggagccatccggcaact
gtcaacgtgcacagcgtggtcatgaaggagttggacatgcgcggcacgattgcgtactgc
aatgaccatcaggaaaccatcaagctggtggaggaaggcaagatcgatctggcgccgttc
atcacgcaacgcatccaactggatgagctgattcgcaaaggattcgacaccctgattcat
aacaacgaatcggccgtgaaaatcatcgttcagccgagactgaagtaa

DBGET integrated database retrieval system