KEGG   Burkholderia sp. CCGE1003: BC1003_2097Help
Entry
BC1003_2097       CDS       T01314                                 

Definition
(GenBank) alpha/beta hydrolase fold protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
bgf00010  Glycolysis / Gluconeogenesis
bgf00020  Citrate cycle (TCA cycle)
bgf00620  Pyruvate metabolism
bgf01100  Metabolic pathways
bgf01110  Biosynthesis of secondary metabolites
bgf01120  Microbial metabolism in diverse environments
bgf01130  Biosynthesis of antibiotics
bgf01200  Carbon metabolism
Module
bgf_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bgf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC1003_2097
   00020 Citrate cycle (TCA cycle)
    BC1003_2097
   00620 Pyruvate metabolism
    BC1003_2097
Enzymes [BR:bgf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BC1003_2097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_6 Abhydrolase_1 Biotin_lipoyl Hydrolase_4 PGAP1 Abhydrolase_8 Abhydrolase_5 Biotin_lipoyl_2 Thioesterase Esterase
Motif
Other DBs
NCBI-ProteinID: ADN58058
UniProt: E1TBR0
Position
1:complement(2430997..2432106)
Genome map
AA seq 369 aa AA seqDB search
MAAITPIVMPKWGLEMREGTVQDWLVREGERIEVGTALLDVDTDKISNSVEAPDAGLLRR
IVAQSGETLPVKALLGVLAEMDVSDAEIDAYIAAFEVPAIDGDDEDAGPAFDYVEVNGIR
VRYARRGPESGTPVLFIHGFGGDLNNWLFNLDAVAEAHPVIALDLPAHGLSQVRLAGTTL
QELAAFVGRFLEAIDVPSAHLVGHSMGGGVAAQLAVDAPGKVRSLALIGSAGFGDEVNAE
YTDGFVRAQSRRELKPVAELLFNDTALVSRQLLDDLLKYKRLDGVGEALGALGTQLFGGG
RQREQPGRALSRFDGPVLVVWGREDRIIPSAHAAAAPAGAVVEVLEGAGHMPQMEKANEV
NALLRRHLG
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggccgcaattaccccgatcgtcatgcccaagtgggggctggagatgcgcgaaggcacg
gtgcaggactggctggttcgggaaggcgagcgcatcgaagtaggaacggcgctgctcgac
gtggacaccgacaagatttccaactcggtggaagcccccgatgcgggactgctgcgccgc
atcgttgcgcagagcggcgagacgctgcccgtcaaggcgttgctcggcgtgctggcggag
atggacgtaagcgatgccgagatcgatgcatacatcgccgctttcgaggtgcccgccatc
gacggcgacgacgaggacgccggcccggcgttcgactacgtcgaggtaaatggcatccgt
gtgcgctatgcgagacgtgggccggagtcgggcacgccggtgctcttcatccacggcttc
ggcggcgatctgaacaactggcttttcaacctcgatgcagtggctgaggcgcatccggtg
atcgcactcgatctgcctgcacacggcctgtcccaggtgcggctcgcgggcacgacgctg
caggaactggccgccttcgtcggccgcttcctggaggcgatcgatgtgccgtcggcccat
ctggtcggccactcgatgggcggcggcgtggccgcgcaactggcggtggatgcgccgggc
aaggtccgttcgctggcgctgatcggcagcgccggcttcggagacgaagtcaacgccgaa
tacaccgacggcttcgtgcgcgcgcagtcgcgccgcgaactgaagcccgtggccgaactg
ctgttcaacgacacggcgctcgtgagccgacagctgctggacgatctgctcaagtacaag
cggctcgacggtgtcggtgaagcgctcggcgcgctcggcacccagctattcggcggcggc
aggcaacgcgagcagcccggccgggcgctcagccgcttcgacgggccggtgctggtggtt
tggggccgcgaggatcgcatcattcccagcgcccatgcggccgccgcgcctgccggcgcg
gtagtggaagtgctcgaaggtgctggccacatgccgcagatggaaaaggccaacgaggtg
aacgcgctgctgcgccggcacctgggctag

DBGET integrated database retrieval system