KEGG   Burkholderia sp. CCGE1003: BC1003_2322Help
Entry
BC1003_2322       CDS       T01314                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
bgf00010  Glycolysis / Gluconeogenesis
bgf00051  Fructose and mannose metabolism
bgf00562  Inositol phosphate metabolism
bgf00710  Carbon fixation in photosynthetic organisms
bgf01100  Metabolic pathways
bgf01110  Biosynthesis of secondary metabolites
bgf01120  Microbial metabolism in diverse environments
bgf01130  Biosynthesis of antibiotics
bgf01200  Carbon metabolism
bgf01230  Biosynthesis of amino acids
Module
bgf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bgf_M00002  Glycolysis, core module involving three-carbon compounds
bgf_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bgf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC1003_2322
   00051 Fructose and mannose metabolism
    BC1003_2322
   00562 Inositol phosphate metabolism
    BC1003_2322
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BC1003_2322
Enzymes [BR:bgf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BC1003_2322
Exosome [BR:bgf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BC1003_2322
  Exosomal proteins of bladder cancer cells
   BC1003_2322
  Exosomal proteins of melanoma cells
   BC1003_2322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADN58275
UniProt: E1T3P1
Position
1:complement(2735893..2736672)
Genome map
AA seq 259 aa AA seqDB search
MSTQRAKLVVGNWKMHGRLADNAGLLQAVAKGAGELPATVRVGVCVPSPYLAQANSLLDG
TRVAWGVQDVSAFTHGAYTGEVAAQMVTDFGATFAIVGHSERRAYHRESAELVAIKTQRA
LEAGLTPIVCVGETLEEREAGATEQVVGAQLDEVLARLSVQEAARIVVAYEPVWAIGTGK
SASSQQAQAVHAFLRARLAAKGAQVAGVPLLYGGSVKPDNAKELFCQQDIDGGLIGGASL
KDQDFLAICKAAAEATAAG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacacaacgagccaaactggtagtgggtaactggaagatgcacgggcgccttgcc
gataacgcggggctcttgcaggccgtggcgaaaggcgcgggcgaactgccggcgacggtg
cgcgtgggtgtgtgcgtgccgagcccgtatctcgcccaggcaaattcgctgctcgacggc
actcgcgtggcgtggggcgtgcaggacgtttcggcgttcacgcacggcgcgtataccggc
gaagtcgccgcgcaaatggtgacggatttcggcgccacgtttgccattgtcgggcattcg
gagcgccgcgcgtatcaccgcgagagcgccgaactcgtcgcgatcaagacgcagcgtgcg
ctggaggcgggtttgacgccgatcgtgtgcgtcggcgaaacgctcgaagagcgggaagcg
ggcgcgaccgaacaggtggttggcgcgcagctggacgaagtgctggccaggttgtcggtg
caggaagccgcgcgtatcgtggtcgcctacgagcccgtctgggcaatcggcacgggcaag
agcgcaagctcgcagcaggcgcaggcggtgcacgcattcctgcgcgcgcgtctcgcggca
aaaggcgctcaagttgcaggcgtgccgctgctgtacggcggcagtgtgaagcccgacaac
gcgaaagagttgttctgtcagcaggatatcgacggcggcctgattggcggtgcgtcgctg
aaggaccaagattttctggcgatctgcaaggcggcggccgaagcgacggccgcaggttga

DBGET integrated database retrieval system