KEGG   Burkholderia sp. CCGE1003: BC1003_2470Help
Entry
BC1003_2470       CDS       T01314                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
bgf00790  Folate biosynthesis
bgf01100  Metabolic pathways
Module
bgf_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bgf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BC1003_2470
Enzymes [BR:bgf01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     BC1003_2470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ADN58423
UniProt: E1T525
Position
1:complement(2907025..2907921)
Genome map
AA seq 298 aa AA seqDB search
MPTAAFSPPIPEPLQCGRFKLSFERPLVMGILNVTPDSFSDGGQYAMHGDALRQAERMML
EGADIIDIGGESTRPGAPPVPLDEELERVIPLIEQLRGANVPLSVDTYKPEVMRRALNAG
ADLINDIWGFRMPGAIDAVRDSDCGLCVMHMLGEPQTMQLGEPAYGDVVSEVSEFLNERV
TALRQAGIARERISVDPGFGFGKAVVEHNYALLARLADSAPPADPPYPILAGMSRKSMIG
AVTGRPAAERVAGSVAAAVLAAERGAAILRVHDVAQTVDALKVWAALRDAANCAGSRS
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
gtgcccacagccgctttctctccccccattcccgagccgttgcagtgcggccggttcaag
ctgagcttcgaacgcccgttggtcatgggcatcctgaacgtcacgcccgattccttctcc
gacggcgggcagtacgcgatgcatggcgacgcgctgcgccaggccgagcgcatgatgctc
gagggcgcggacattatcgacattggcggcgaatcgacgcgccccggcgctccgcccgtt
ccgctcgacgaggagctggaacgcgtgattccgctcattgagcagctgcgcggtgcgaac
gtgccgctttccgtcgatacctacaagcccgaagtgatgcgccgcgcactgaacgcgggg
gccgatctgatcaacgatatctggggttttcgcatgcccggcgcgattgacgcagtgcgc
gacagcgactgtggtctatgcgtgatgcatatgctcggcgagccacagaccatgcaactc
ggcgagccggcttacggcgatgtcgtgagcgaagtcagcgagtttctaaacgagcgcgtg
acggcgctcagacaggcaggcattgcgcgcgagcggatcagcgtggacccgggtttcggt
ttcggcaaggcggtggtcgagcacaattacgcgctgctcgcgcgtcttgccgacagcgcg
ccgcccgccgatccgccgtacccgatcctcgcgggcatgtcgcgtaagtcgatgatcggc
gcggtcaccgggcgcccggcggccgagcgcgtcgcgggcagcgtcgccgcagcagttctg
gcggctgaacgcggcgcggcgatcctgcgcgtgcacgatgtcgcgcaaacagtagacgca
ttgaaagtatgggcagccctgcgcgacgcggcgaactgcgccggctcgcgcagctaa

DBGET integrated database retrieval system