KEGG   Burkholderia sp. CCGE1003: BC1003_3032Help
Entry
BC1003_3032       CDS       T01314                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
bgf00330  Arginine and proline metabolism
bgf00332  Carbapenem biosynthesis
bgf01100  Metabolic pathways
bgf01130  Biosynthesis of antibiotics
bgf01230  Biosynthesis of amino acids
Module
bgf_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bgf00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BC1003_3032
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    BC1003_3032
Enzymes [BR:bgf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BC1003_3032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ADN58981
UniProt: E1TA04
Position
1:complement(3533863..3534981)
Genome map
AA seq 372 aa AA seqDB search
MRSVIADSRRLVVKVGSSLVTNDGRGLDHAAIGRWAAQIAALRAQGKEVVLVSSGAIAEG
MQRLGWTKRPREIDELQAAAAVGQMGLAQVYESRFAEHSIQTAQILLTHADLADRERYLN
ARSTLLTLLRLGVVPIINENDTVVTDEIKFGDNDTLGALVANLIEGDALIILTDQQGLFT
ADPRKDPHATLVQQADAGAPDLEAMAGGAGSSLGRGGMLTKILAAKRAAHSGANTVIASG
READVLSRLASGEAIGTQLIARTARMAARKQWMADHLQVRGHVVIDDGAVEKLTAGGKSL
LPIGIVGVQGAFARGEVIACLNAAGREVARGLTNYSSAETKLIQRRPSGEIESVLGYMLE
PELIHRDNLVLV
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcgttccgtcatcgcagattcacggcgattggtagtgaaagtcggctcgagcctcgtc
accaacgacgggcgcggcctcgatcatgcggccatcggtcgctgggctgcgcagattgcg
gcgttgcgcgcgcaaggtaaagaggtcgtgctggtgagttcaggtgccattgcagagggc
atgcagcggctcggctggaccaaacggccgcgtgaaatcgacgaacttcaggctgcagcc
gctgtgggccaaatgggcttggctcaggtctacgagagccgctttgccgagcattccatc
cagaccgcgcaaattctgctgacccacgccgatctggcggaccgcgagcgctatctgaat
gcacgctccacgctgctgacgctgctgcgacttggcgtggtgcccatcatcaacgaaaac
gacacggtcgtgaccgacgagatcaagttcggcgacaacgacacgctcggcgccctcgtg
gcgaacctgatcgagggtgacgcactcatcatcctgaccgatcaacaagggctctttact
gccgatccgcgtaaagatccgcatgcgacgttggtccagcaagcggatgctggcgcgccg
gacctcgaagccatggccggcggcgcgggttcgagcctcggccgtggcggcatgctgacc
aagattctggctgccaagcgggccgcgcacagcggcgcgaacaccgtgatcgcaagcggc
cgcgaagccgacgtgctgtcgcgactagcctccggcgaagcgatcggcacgcaattgatc
gcccgcaccgcgcgcatggccgcgcgcaagcaatggatggcggaccatctgcaggtgcgc
ggccacgtggtgatcgacgacggtgccgtcgagaagctgaccgcaggtggcaagagccta
ttgcctatcggaatcgtgggcgtgcagggtgcgtttgctcgcggcgaagtgatcgcgtgc
ctgaacgcagcgggccgcgaagtcgcgcgtggcctcaccaactacagcagtgcggaaacg
aagctgatccagcggcgccccagcggtgagattgaatctgtgcttggctatatgctggag
ccggagctgattcatcgtgacaacctggtgctggtttga

DBGET integrated database retrieval system