KEGG   Burkholderia sp. CCGE1003: BC1003_3160Help
Entry
BC1003_3160       CDS       T01314                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
bgf00340  Histidine metabolism
bgf01100  Metabolic pathways
bgf01110  Biosynthesis of secondary metabolites
bgf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bgf00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    BC1003_3160
Enzymes [BR:bgf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     BC1003_3160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh Rieske
Motif
Other DBs
NCBI-ProteinID: ADN59107
UniProt: E1TAS8
Position
1:complement(3675116..3676438)
Genome map
AA seq 440 aa AA seqDB search
MSIKIRKLDSAASDFRKSLHAVLAFEASEDEAIERSVAQILSDVKARGDAAVLEYTNRFD
RLNAQNVAALELPIAELEAALEGLEPKRRASLEAAAARVRGYHEKQKIECGSHSWQYTEA
DGTVLGQKVTPLDRAGIYVPGGKAAYPSSVLMNAIPARVAGVREIVMVVPTPDGVKNPLV
LAAALLGGVDRVFTIGGAQAVAALAYGTETVPAVDKICGPGNAYVASAKRRVFGTVGIDM
IAGPSEILVLCDGTTDPRWVAMDLFSQAEHDELAQSILLCPDDAFIGRVQDAIDELLPTM
PRRDVIQASLEGRGALVKVRDMAEACAIANDIAPEHLEISALEPHQWGQLIRHAGAIFLG
RYTSESLGDYCAGPNHVLPTSRTARFSSPLGVYDFFKRSSLIEVSAEGAQTLGEIAAELA
YGEGLPAHARSAEYRMRQGS
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcaagattcgcaaactcgattccgccgcttccgacttccggaagtcgctgcac
gcggtgctcgcgttcgaggcgagcgaagacgaagcaatcgagcgctcagtcgcgcagatt
ctgagcgacgtgaaggcgcgcggcgacgcggcggtgctcgagtacacgaaccgcttcgac
cggctcaacgcacagaacgtcgcggcgctggagttgcctatcgcggaactggaagcggcg
ctcgaaggcctggagccgaagcgccgggcctcgctcgaagccgcggcggcgcgcgtgcgc
ggctaccacgagaagcagaagatcgaatgcggcagccatagctggcaatacacggaagcc
gacggcacggtgctcggccagaaggtgacgccgctcgaccgcgcgggcatctacgtgccg
ggcggcaaggcggcgtatccgtcgtcggtgctgatgaatgcgattccggcgcgcgtggcg
ggcgtgcgcgaaatcgtcatggtcgtgccgacaccggacggcgtgaaaaatccgctggtg
ctggcggctgccttgctcggcggcgtggaccgcgtgtttaccatcggcggcgcgcaagcc
gtggccgcgctcgcgtacggcaccgaaaccgtgcccgcggtcgacaaaatctgcggcccg
ggcaatgcttatgtagcgtcggccaaacgccgcgtattcggcacggtgggcatcgacatg
attgccgggccgtctgaaattctggtgctgtgcgacggcacgactgatccgcgctgggtt
gcaatggacctgttctcgcaggccgagcacgacgaactcgcgcagtccattctgctgtgt
ccggacgacgcgttcattggccgcgtgcaggacgccatcgacgaattgctgcccaccatg
ccgcgccgcgacgtgatccaggcgtcgctggaagggcgcggcgcgctcgtcaaggtgcgc
gacatggccgaagcctgcgcgattgccaacgacattgcgcccgagcacctggaaatttcg
gcgctcgagccgcatcagtgggggcaactcatccgccatgcgggcgccattttccttggc
cgctacacgagcgagagtctcggcgactattgcgccgggccgaaccatgttctgcctacg
tcgcgcaccgcacggttttcgtcgccgctcggggtctatgatttcttcaagcgctcgagc
ctgatcgaggtaagcgcggaaggcgcgcaaacgctcggcgagatcgctgccgagctggct
tacggcgaaggcttgccggcgcacgcccgcagcgcggaataccggatgcgccaaggtagc
tga

DBGET integrated database retrieval system