KEGG   Burkholderia sp. CCGE1003: BC1003_3179Help
Entry
BC1003_3179       CDS       T01314                                 

Definition
(GenBank) two component transcriptional regulator, winged helix family
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
bgf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bgf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BC1003_3179
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bgf02022]
    BC1003_3179
Two-component system [BR:bgf02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   BC1003_3179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ
Motif
Other DBs
NCBI-ProteinID: ADN59126
UniProt: E1TB92
Position
1:3692923..3693666
Genome map
AA seq 247 aa AA seqDB search
MNPSILVVDDDPVVRNLVSQYLEGRGFKVATLEHGMALQSKLRDERPALVVLDIMMPELD
GISALRALRVAGDDIPVILLTARADPIDRVIGLELGADDYLGKPFEPSELVARIRTVLRR
RGSIAPSAPEQRAPYRFGRFEVNFPARELRRDGERIALRSSEFAMLKVFVTHAMTVLTRA
QLLEKLHGNSEAHRNRSLDVSIWRLRRLIEVDPSEPRYVQTVWGRGYVFVPDGEIGAAER
GPATLAE
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaacccatccattctggtcgtcgacgacgaccccgttgtccgcaatctcgtcagccag
tatctcgaagggcgcggtttcaaggtcgccacgctcgagcacggcatggcattgcaaagc
aagctgcgcgacgaacgtcccgcgctggtcgtgctcgacatcatgatgccggagctcgac
ggcatcagtgcgctacgcgcgttgcgcgtggcgggcgacgacattcccgtgattctgctc
accgcacgcgccgatcctatcgaccgtgtgatcggtcttgagctcggtgccgacgattat
ctcggcaagccgttcgagccgagtgaattggtcgcgcgaatccgcacggtgctgcggcgg
cgcggctcgattgcgccgagcgcgcccgaacagcgcgcgccttaccggttcggccgcttt
gaagtgaatttcccggcgcgcgaattgcgccgcgacggcgagcgcatcgcgctgcgctcg
agcgaattcgcgatgctgaaagtgttcgtcacgcacgcgatgaccgtgctcacgcgcgcg
caactgctggagaaactgcacggcaacagcgaggcgcatcgcaaccgcagtctcgatgtg
tcgatctggcgtttgcgccggctaatcgaggtggatccgtccgagccgcgctacgttcaa
acggtctggggacgcggctacgtgttcgtgcccgacggcgagataggcgcagccgagcgc
ggcccggccacgcttgcagaataa

DBGET integrated database retrieval system