KEGG   Burkholderia sp. CCGE1003: BC1003_5011Help
Entry
BC1003_5011       CDS       T01314                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
bgf00010  Glycolysis / Gluconeogenesis
bgf00053  Ascorbate and aldarate metabolism
bgf00071  Fatty acid degradation
bgf00280  Valine, leucine and isoleucine degradation
bgf00310  Lysine degradation
bgf00330  Arginine and proline metabolism
bgf00340  Histidine metabolism
bgf00380  Tryptophan metabolism
bgf00410  beta-Alanine metabolism
bgf00561  Glycerolipid metabolism
bgf00620  Pyruvate metabolism
bgf00625  Chloroalkane and chloroalkene degradation
bgf00903  Limonene and pinene degradation
bgf01100  Metabolic pathways
bgf01110  Biosynthesis of secondary metabolites
bgf01120  Microbial metabolism in diverse environments
bgf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bgf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC1003_5011
   00053 Ascorbate and aldarate metabolism
    BC1003_5011
   00620 Pyruvate metabolism
    BC1003_5011
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BC1003_5011
   00561 Glycerolipid metabolism
    BC1003_5011
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BC1003_5011
   00310 Lysine degradation
    BC1003_5011
   00330 Arginine and proline metabolism
    BC1003_5011
   00340 Histidine metabolism
    BC1003_5011
   00380 Tryptophan metabolism
    BC1003_5011
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BC1003_5011
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BC1003_5011
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BC1003_5011
Enzymes [BR:bgf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BC1003_5011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ADN60934
UniProt: E1TJK9
Position
2:1716442..1717869
Genome map
AA seq 475 aa AA seqDB search
MHNIDTVYIDGAFVTPHGDEAFDLFNPATEGVIGRVRLADEVDADNAIAAAKRAFADFSQ
TSRGERIEMLERMHAALAAREDALFDAIVDEYGAPVSRARWMARHAAEVLMEAARMLEHY
PFTRRAGSAEVTMQPLGVAGLITPWNNDAGFICGKLTAALSAGCTAVIKPSEMSAMQTRV
VTEALHEAGLPRGVFNIVTGKGESVGARISAHPDVAKLSFTGSTAVGKTILRTGADTLKR
VTLELGGKSPFIVLDDADLDEAAKLALAAGFMNSGQACVAGTRILVPRALLAAFEASMVR
QLADVRAGNPRDPATTVGPMVSAKQWQRVQRYIRVGIDEGARLIAGGEGRPQGIQAGWFV
RPTVFSDVRNDMTIAREEIFGPVLSIIAYRDDEEAVAIANDTVYGLQAYVVSANVQRARL
IASRIEAGRVLVNTLAHEPAAPFGGFKQSGIGREYGTYGLEAYLEPKAVLGVTGG
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgcacaacatcgacacggtctatatcgacggcgcgttcgtcacgccgcacggcgacgaa
gcgttcgacctcttcaatccggcgacggaaggcgtgatcggccgcgtgcggcttgcggac
gaagtcgatgcggacaacgcaatcgcagcggccaagcgcgcgttcgcggacttttcgcag
accagtcgcggcgagaggatagagatgctcgaacgcatgcacgccgcgcttgcggcgcgc
gaagatgcattgttcgacgcgatcgtcgacgaatacggtgcgcccgtttcgcgcgcccgc
tggatggcgcggcacgccgccgaggtgctgatggaagcggcgcgcatgctcgaacactat
ccattcactcgccgcgcgggcagtgcggaggtgaccatgcagccgcttggcgtggccggc
ctcattacgccctggaacaacgatgcaggctttatctgcggcaagctcacggcggcgttg
tcggctgggtgtacggctgtcatcaagccgagcgagatgagcgccatgcagacgcgggtt
gtcaccgaagcattgcacgaagccggtttgccccgcggcgtattcaacatcgtgacgggc
aagggcgagagtgtgggcgcgcgcatcagtgcgcatcccgatgtggcaaagctgtcgttc
acgggatcgacggcggtcggcaagacaatcttgcgcacgggcgcggacacgctcaagcgc
gtgacgctggaactcggcggcaaatcgccgttcatcgtactcgacgacgcggatctcgac
gaagccgcgaaactggcgcttgccgccggcttcatgaacagcggtcaggcatgcgttgcg
ggcacccgcattctggtgccccgtgcactgctcgccgcgtttgaagcaagcatggtaagg
cagcttgccgacgtgcgcgccggaaatccacgcgatcccgcgacgaccgtgggtccgatg
gtcagcgcgaaacagtggcagcgagtgcaacggtacattcgcgtcggcatcgacgagggc
gcacggctaattgcgggcggcgaagggcggccgcagggcatacaggcgggctggttcgtt
cgcccgaccgtgttcagcgacgtgcgcaacgatatgaccatcgctcgcgaggagattttc
gggccggtgctgtcgatcatcgcctatcgcgacgacgaggaagccgtggcgattgcgaac
gacacggtgtacggcctgcaggcgtacgtggtttcggcgaatgtgcaacgggctcgcctg
atcgcttcgcgcatcgaggcagggcgcgtgctcgtcaacacactcgcgcacgaacctgcc
gcgccgttcggcggtttcaagcagtcgggcatcgggcgcgagtatggtacatatgggctc
gaagcctatctcgagccgaaggcggtgctgggcgttacgggcgggtga

DBGET integrated database retrieval system