KEGG   Burkholderia sp. CCGE1003: BC1003_5683Help
Entry
BC1003_5683       CDS       T01314                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
bgf00053  Ascorbate and aldarate metabolism
bgf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    BC1003_5683
Enzymes [BR:bgf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     BC1003_5683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD NAD_binding_10 NAD_binding_4 Polysacc_synt_2 NmrA RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: ADN61598
UniProt: E1TG57
Position
2:2462828..2463619
Genome map
AA seq 263 aa AA seqDB search
MKKIALSGAGGQLGSVVRAAFIARGTPLRSAAGSKPLTPLVDGEDVMHGDLRDPAVVDRL
LDGVDVLIHFAGTSVERPLPEIIENNLRGLVEVYEGARRHGVKRIVFASSNHAIGMYPVT
ERLSLDCELRPDGFYGLSKVWGEALARMYWDKHGIESVCVRIGSCLERPTEPRHLSTWFG
HADLMHFLDRCIEAEELGFLTVWGVSANTRSWWDNSRAARLGYTPTQNAEDYAEEVLARP
NPLDALGQRFQGGGFVGIDYSRD
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatcgccctcagtggcgcaggtggccagctcggctcggtcgtgcgcgccgca
ttcattgcgcgcggcacgccgctgcgctcggcggccggctcgaaaccgcttacgccgctc
gtcgacggcgaagacgtgatgcacggcgacctgcgcgatccggcggtggtcgatcgtctg
ctcgacggtgtggacgtgctgatccactttgccggcacgagcgtcgagcgcccgctgccc
gagatcatcgaaaacaacttgcgcggcctcgtcgaagtgtacgaaggcgcgcggcgccac
ggcgtcaagcgcatcgtgttcgcgagttccaatcacgctatcggcatgtaccccgtgacc
gagcgtctgtcgctcgactgcgagctgcgtccagacggcttctacggcctcagcaaggtg
tggggcgaggcgctcgctcgcatgtactgggacaagcatggcatcgagagcgtgtgcgtg
cgcattggcagttgtctcgaacggccgaccgaaccgcgccatctgagcacctggttcggc
catgccgatctgatgcatttcctcgatcgctgcatcgaggcagaagagctgggctttctc
accgtgtggggcgtgtcggccaatacgcgcagctggtgggacaacagccgcgcggcgcgc
ctcggctacacgcccacgcagaacgccgaggactacgccgaagaagtgctggcccgaccc
aatccgctcgatgcattgggccagcgcttccagggcggcggcttcgtcggcatcgactat
tcgcgcgattga

DBGET integrated database retrieval system