KEGG   Burkholderia sp. CCGE1003: BC1003_5731
Entry
BC1003_5731       CDS       T01314                                 

Definition
(GenBank) type IV / VI secretion system protein, DotU family
  KO
K11892  type VI secretion system protein ImpK
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
bgf03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bgf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BC1003_5731
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bgf02044]
    BC1003_5731
Secretion system [BR:bgf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BC1003_5731
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: ADN61644
UniProt: E1TGH8
Position
2:complement(2516822..2517601)
AA seq 259 aa
MSYAPSLFGGSTPAATPLPASEPSYQVRSLLDLLYDGFFMLFLLKNGREPGEAHEFSQRI
QQFLGDFERGAKKLNASAEDVYASKFAFCAAIDESVLSSTFRIRADWERRPLQLVLFGEQ
LAGEKFFQYLEECRAQGAARLQSLEVFHMCLLLGFQGKYLLEGPEKLAYLTARLGDEIAH
MKGKRAPFAPHWQLPDQVAHRLKREVPLWSIGAVFALVGLLAYLGLNTYLRDQTLRTLAP
YSQVVKLGPQSATLTISLP
NT seq 780 nt   +upstreamnt  +downstreamnt
atgagctacgcgccttcactattcggcggcagcacgcctgccgcgacgccgttgccggca
agcgaaccgagctaccaggtccgctcgctgctcgatctgctgtacgacggcttcttcatg
ctgttcctgttgaagaacggccgcgagcccggcgaggcgcacgagttcagtcagcgcatt
cagcagtttctcggcgacttcgagcgcggcgcgaagaagctcaacgcatccgcggaagac
gtgtatgcgtcgaagtttgcattctgcgcggcgatagacgagtcggtgttgtcgtccacc
ttcaggattcgcgccgactgggagcgccggccactgcaactcgtgctgttcggcgagcaa
ctggcgggggaaaaattcttccagtatctcgaggaatgccgcgcacaaggcgcggcgcgc
ttgcagtcgctcgaggtgttccacatgtgcctgctgctcggctttcagggcaagtatctg
ctggaagggccggagaagcttgcgtatctgaccgcgcgcctcggcgacgaaatcgcgcac
atgaagggcaagcgggcgccgttcgcgccgcactggcaactgcccgaccaggtcgcgcac
cgtctcaagcgtgaagtgccgttgtggtcgatcggcgcagtgttcgccctggtcggactg
ctcgcgtatctgggcttgaacacctatctgcgcgatcagaccttgcgcacgctggcgccg
tattcgcaagtggtcaagctggggccgcagtcggccacgctgaccatctcgctgccgtag

DBGET integrated database retrieval system