KEGG   Burkholderia sp. CCGE1003: BC1003_5732
Entry
BC1003_5732       CDS       T01314                                 

Definition
(GenBank) type VI secretion protein, VC_A0114 family
  KO
K11893  type VI secretion system protein ImpJ
Organism
bgf  Burkholderia sp. CCGE1003
Brite
KEGG Orthology (KO) [BR:bgf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bgf02044]
    BC1003_5732
Secretion system [BR:bgf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BC1003_5732
SSDB
Motif
Pfam: T6SS_VasE DUF5655
Other DBs
NCBI-ProteinID: ADN61645
UniProt: E1TGH9
Position
2:complement(2517598..2518995)
AA seq 465 aa
MGLFGARSTLNPYNRFEMSYSAKVLWGEGLFLRPQHFQRQDAYHEARLFESIQAIQPYNW
GVRSARFDRDALGSNVLRVSELSLVFPDGALYSAPQADDLPPPIALDTLPDGINEFTFYL
ALHPLRETGANYSQDSNAGFVARYVSEQAPVADHFTDAAEADITFLKTSVKLIAHSEPRD
QLLSVPLVRVRRTATSGFEIDDSFVPPCLAIDASPVLHQRLRQLIDALQAKVSALYGFHR
EPTKNIIEFRSGDIASFWLLHTASAAFAALAHLYQHSALHPERLFQELLRLAGQLMTFSK
GYALSDLPAYRHDDPGPGFARLDMILRDLLETVISTRYFAIALEEVRPSFHAGRLDSGKI
DDKTMFYIAVSADMPTAELVEAVPARFKVGAPDDVDKLVLSAMPGVRLVYTPQVPPAIPV
RPGACYFSFEPRGGLYERMLQAQSAMIYAPSGINDLQLELIAVTS
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgggcttattcggggcgcgcagcacgctgaacccatataacaggtttgagatgagttat
tccgcaaaagtgctctggggggaaggcctgtttctcaggccgcagcattttcagcgtcag
gacgcctatcacgaggcgcgcctcttcgagtcgatccaggcgatccaaccgtacaactgg
ggcgtgcgctccgcgcgtttcgaccgcgacgcgctcggcagcaatgtgctgcgcgtgagc
gaactgtcgctggtgttccccgacggcgcgctctactccgcaccgcaagcggacgacctg
ccgccgcccatcgcactcgacacgttgcccgacggcatcaacgaattcacgttctatctc
gcgctgcatccgctgcgcgagacaggcgcgaactattcgcaggacagcaacgcgggcttc
gttgcgcggtacgtgagcgagcaggctccggtcgccgaccatttcacggacgcggcggaa
gcggacatcaccttcctcaagaccagcgtcaagctgatcgcgcacagcgagccgcgcgac
cagttgctgtcggtgccgctcgtgcgcgtgcgccgcactgccacctcgggcttcgagatc
gacgacagtttcgtgccgccctgcctcgccatcgacgcctcgccggtcctgcatcagcgg
ctgcgccaactgatcgacgcgctgcaggcaaaggtcagcgcgctgtacggctttcaccgc
gagccgaccaagaacatcatcgagttccgttcgggcgacattgcgtcgttctggctgctg
cacacggcgagcgcggcgtttgcagcgcttgcgcatctttaccagcattcggcgctgcat
ccggagcggctctttcaggaactgctgcgcctcgcgggccagttgatgacgttctccaag
ggctatgcgctctccgacctgccggcttaccggcacgacgatcctggtcccggctttgcg
cggctcgacatgattctgcgcgacttgctcgagaccgtcatctccacgcgctactttgcg
atcgcgcttgaagaagtgcgtccatcgtttcatgcggggcggctcgactccggcaagatc
gacgacaagacgatgttctacattgccgtgtccgccgacatgcccaccgccgaactggtc
gaagcagtaccggcacgcttcaaggtcggcgcgccagacgacgtcgacaagctggtgctc
tcggccatgccgggcgtgcggctcgtgtacacgccgcaagtgccgcccgccattccggtg
cggccgggcgcctgctacttctcgttcgagccgcgcggcgggctgtacgagcgcatgctg
caagcgcagtcggccatgatctatgcgccctcgggcatcaacgatcttcaacttgaactg
atcgcggtcacatcatga

DBGET integrated database retrieval system