KEGG   Burkholderia sp. CCGE1003: BC1003_5733
Entry
BC1003_5733       CDS       T01314                                 

Definition
(GenBank) type VI secretion lipoprotein, VC_A0113 family
  KO
K11906  type VI secretion system protein VasD
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
bgf03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bgf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BC1003_5733
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bgf02044]
    BC1003_5733
Secretion system [BR:bgf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BC1003_5733
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: ADN61646
UniProt: E1TGI0
Position
2:complement(2519053..2519757)
AA seq 234 aa
MSGGHFAEIISLSMFRRGTAASRSMDMNSRLVRHASLLITQAAACALLGGCAAGVSVLGA
AANAALQASGLGKPELPDAQKPPRNVPVTLYAAPNLNAANDKRPLALVVRLYILKDPTSF
QQAPFDAFTDAAKEKTTLGGDLLGVREVTLIPGQRYVVTEKVSREAQAFGIVALFRDPAM
QRWKFAFDPAKSEKSGIMVGLHNCAMTVTNGTVIPPEQGLPAQPLNMLSSVSCG
NT seq 705 nt   +upstreamnt  +downstreamnt
atgagtggcggacatttcgctgaaatcatttcgttatcaatgtttagacgggggacggcg
gccagccggtcgatggatatgaattcgcgccttgttcgccatgcatcgctattgattacc
caggctgccgcgtgtgcgcttctgggcggttgcgccgccggcgtctccgtgctcggagcc
gccgccaacgcggctttgcaggcaagcggccttggcaagcccgaattgccggacgcgcag
aaaccgccgcgcaacgtgcctgtcaccttatacgcggcgcccaatctgaatgccgcgaat
gacaagcggccattggctctggtggtgcgactttacatattgaaagacccgacttcattc
cagcaggctccattcgacgcatttacggacgcggcgaaggaaaagaccacactcggcggc
gatctgcttggcgtgcgtgaagtcacgctaatcccgggccagcgttacgttgtgaccgaa
aaagtgtcgcgtgaagcgcaggcattcggtatcgtcgcgctattccgcgatcccgccatg
cagcgttggaaattcgccttcgacccggcaaagtcggagaaatccggcataatggtcggc
ctgcataactgtgcaatgaccgtcaccaacggtaccgtgatcccgccggaacagggattg
cccgcccagccgctcaatatgctttcttcggttagctgcggttaa

DBGET integrated database retrieval system