KEGG   Burkholderia sp. CCGE1003: BC1003_5735
Entry
BC1003_5735       CDS       T01314                                 

Definition
(GenBank) type VI secretion protein, VC_A0107 family
  KO
K11901  type VI secretion system protein ImpB
Organism
bgf  Burkholderia sp. CCGE1003
Brite
KEGG Orthology (KO) [BR:bgf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bgf02044]
    BC1003_5735
Secretion system [BR:bgf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BC1003_5735
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ADN61648
UniProt: E1TGI2
Position
2:2520778..2521326
AA seq 182 aa
MAKKESIQKRLQKVRPPRVQLTYEVERGDAIEVKELPFVVGVVADLAGQSEVEQPKLRDR
KFVNIDRDNFDDVMKAIEPRAAFQVENRLSETGGKFAVDLRFKSMADFNPDEVVAQIEPL
RRLLEARSKLADLRNKLAGNDKLEDLLSEVLNNTQQLQALAKDQGNAADRDGGAPDHDKQ
GE
NT seq 549 nt   +upstreamnt  +downstreamnt
atggcgaagaaagaaagcatacaaaaacgcttgcagaaagtgcggccgccccgcgtgcag
ctcacctatgaggtcgagcgcggcgatgcgatcgaagtgaaggaactgccgttcgtggtc
ggcgtggtggccgatctcgccgggcagtccgaagtcgagcagcccaagctgcgcgaccgc
aagttcgtcaacatcgatcgcgacaatttcgacgacgtgatgaaggcgatcgagccgcgc
gcggcctttcaggtggaaaaccgtctgagcgaaaccggcggcaaattcgcggtcgatctg
cggttcaagtcgatggccgatttcaatccggacgaggtggtcgcgcaaatcgaaccgctg
cgccgtctgcttgaagctcgctcgaagctcgcagatttgcgcaacaagcttgccggcaat
gacaagctcgaagacctgctttccgaagtgctcaacaacacgcagcagttgcaggcactg
gcaaaagaccagggcaatgcggcggaccgggacggcggcgcgccggatcacgacaagcaa
ggcgaataa

DBGET integrated database retrieval system