KEGG   Burkholderia sp. CCGE1003: BC1003_5737
Entry
BC1003_5737       CDS       T01314                                 

Definition
(GenBank) type VI secretion system effector, Hcp1 family
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
bgf03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bgf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BC1003_5737
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bgf02044]
    BC1003_5737
Secretion system [BR:bgf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BC1003_5737
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ADN61650
UniProt: E1TGI4
Position
2:2522905..2523408
AA seq 167 aa
MKDIYLKFGNPAIKGESADKDHAGWIEIDSWSHSITQPRSATASTAGGHTSERCEHADMV
FTKDIDVVSPLIYQHASGGTTFDEVTIDFMRSDGEGNRIKYLEVKLKYVIISSVTPSVVG
EGLPSEQFSLKYAAVQWKYTQQKIGGNQGGNAQGAWSLTKNDKTYAV
NT seq 504 nt   +upstreamnt  +downstreamnt
atgaaggacatctatttaaaattcggcaatccggcgatcaaaggcgagtccgccgataaa
gatcacgctggctggatcgaaattgattcgtggagccactcgatcacgcagccgcgttcg
gcaacggcttctaccgcgggcggtcacacctcggagcgttgtgagcatgccgacatggtg
ttcacaaaagacatcgacgtggtgagcccgctgatttatcagcacgcatcgggcggcacg
acgttcgacgaagtcacgatcgacttcatgcgttcggacggcgaaggcaaccgtatcaag
tatctggaagtcaagctgaagtacgtgatcatttccagcgtgacgccgagcgtggtcggt
gaaggcctgccgagcgagcagttctcgctgaagtacgccgctgtgcagtggaagtacacg
cagcagaagatcggcggcaaccagggcggcaacgcgcaaggcgcgtggagcctgacgaag
aacgacaagacgtacgcggtgtaa

DBGET integrated database retrieval system