KEGG   Burkholderia sp. CCGE1003: BC1003_5740Help
Entry
BC1003_5740       CDS       T01314                                 

Definition
(GenBank) type VI secretion protein, VC_A0111 family
  KO
K11895  type VI secretion system protein ImpH
Organism
bgf  Burkholderia sp. CCGE1003
Brite
KEGG Orthology (KO) [BR:bgf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bgf02044]
    BC1003_5740
Secretion system [BR:bgf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BC1003_5740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssG
Motif
Other DBs
NCBI-ProteinID: ADN61653
UniProt: E1TGI7
Position
2:2525888..2526982
Genome map
AA seq 364 aa AA seqDB search
MQTAQRRIDPGVVEQLLDEPHRFEFFQAVRVLEKWFAQQAPSATGRSGDIVAQRIAFRNS
LSMSFPPSEIHGAQSYDDEGTALKEKAQRTAALESGSLEKVDITPAFFGLLGGQGALPLH
YTEQIIAREQIKRDRAAREFFDVFSNRATALFYAAWKKYRLPFHYELDRDERYLPLLLAL
AGVADNDTRSSLQSGEGALFDEAIAGYALPTRHRPVSAAYLQRTLSDYFRVPVRVEQFVG
KWYNVPRDQLTVLGSVNATLGATALAGERVWQRDMRARLVIGPLDKADYEAFLPGADRAI
ALERMLTLLAGVTLEYEVKLVLRREAVGPTLLSQGARLGWDAFLCTRDADRDRADARYEL
HVIH
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccgcgcagcggcgaatcgatcctggcgtagtcgagcagcttctcgacgagccg
caccgctttgaattctttcaggcagtgcgcgtgctcgagaagtggttcgcacaacaggcg
ccatcggccaccgggcgttcgggcgatatcgtcgcgcagcgcattgcgtttcgcaattcg
ctttcgatgtcgtttccaccgagtgagattcacggcgcgcaatcttacgacgacgaaggc
accgcgctaaaagaaaaggcgcaacgtactgcggcgctggaaagcggctcgctcgaaaag
gtggacatcacaccggcgtttttcggtttgctcggcgggcagggcgcattgccgctgcac
tacaccgaacagatcatcgcgcgcgagcagatcaagcgtgatcgcgccgcacgcgagttc
ttcgatgtgttttcgaatcgggccaccgcgctcttttatgcggcgtggaagaagtaccgt
ctgccctttcattatgaactggaccgcgacgaacgctatttgccgctgctgcttgcgctt
gccggcgtggccgacaacgacacgcggagcagcctgcaaagcggcgaaggcgcgctattc
gacgaagccattgcgggttacgcactaccgacacggcacaggcccgtgtccgccgcgtac
ctgcaacgcacactgtcggactatttcagggttccagtgcgtgtcgaacagtttgtcggc
aagtggtacaacgtcccgcgcgatcaattgaccgtgctcggcagcgtcaacgcgacactc
ggcgcgacggcgctggcgggcgagcgcgtctggcagcgcgacatgcgggcgcggctcgtg
atcggcccgctcgacaaggccgactacgaggccttcctgccgggcgcggatcgtgccatt
gcgctcgaacggatgctgaccctgctcgcgggcgtcacgctcgaatatgaagtgaagctg
gtactgcggcgtgaggcagtagggccgacgcttttgagccagggcgcacgccttggctgg
gacgcctttctttgtacgcgcgacgcagaccgcgaccgcgcggacgcgcgctacgagctg
cacgtgattcactga

DBGET integrated database retrieval system