KEGG   Burkholderia sp. CCGE1003: BC1003_5741
Entry
BC1003_5741       CDS       T01314                                 

Definition
(GenBank) type VI secretion ATPase, ClpV1 family
  KO
K11907  type VI secretion system protein VasG
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
bgf03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bgf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BC1003_5741
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bgf02044]
    BC1003_5741
Secretion system [BR:bgf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BC1003_5741
SSDB
Motif
Pfam: AAA_2 AAA_lid_9 AAA AAA_5 Clp_N ClpB_D2-small Sigma54_activat AAA_16 AAA_7 TniB AAA_29 AAA_23 NACHT ResIII SRP54 T2SSE AAA_33 TMCO5
Other DBs
NCBI-ProteinID: ADN61654
UniProt: E1TGI8
Position
2:2527016..2529691
AA seq 891 aa
MSTSLNTLIAKLNPTCRQAALQAANNCLARGHYEVDLEHLLLALLDEPASDLALVLRASS
IDLHALRADIERELQRLKSGNTRTPVFSRHLIDLLEQAWLIASLDSQIGRIRSGHLLLAL
LSAPDLAQFAERMSPLWRDVRVTDLKHKFDELTAGSCEVERSQDGQAATDRADDPATSAS
MPGTPSRTPALDTYTSNLTQRAREGKIDPVIGREGEIRQTIDILMRRRQNNPIMTGEAGV
GKTAVVEGLALRIAADDVPAPLKGVALHVLDMGLLQAGASVKGEFENRLKSVIDEVKKSP
HPIILFIDEAHTIIGAGGQAGQNDAANLLKPALARGELRTIAATTWSEYKKYFEKDAALA
RRFQVVKIEEPSETLAAAMLRGMASLMEKHFNVRVLDDAITEAVRLSHRYISGRQLPDKA
ISVLDTACAKVALAHSSTPAAIDDTKKRLERIDAEIAALEREAASGAQHDERLAQLRELR
EEDLQHLAEDEARYDRERALVTEIVDLRAEIDAARVSSADAQQAEKAQQARETLALRVAE
LQALQGTQPMVPLQVDGHVVAEIVASWTGIPLGRMVKDEIQTVLNLQPLLAARVIGQDHA
LEAIAQRVRTASANLEDPNKPRGVFMFVGPSGVGKTETALALADVLYGGERKMVTINMSE
YQEAHSVSGLKGSPPGYVGYGEGGVLTEAVRRNPYSVVLLDEVEKAHPDVLEMFFQVFDK
GTMDDAEGREIDFRNTLIILTSNVGSQAVMQACLNKSAEELPDADALAETLRPQLYKAFK
PAFLGRMKVVPYYPISDDVLAEIIELKLERIRRRIESNHKAVFEWDESLVDAVLARCTEV
DSGARNVDHILNGTLLPEVAQHVLERIANGATIERISVRSSEAGEFEYAVV
NT seq 2676 nt   +upstreamnt  +downstreamnt
atgagtacgtccctcaacaccctgatcgccaaactcaatccgacctgccggcaggcagcg
ttgcaggcggcaaacaactgtctcgcgcgcggtcattacgaggtggacctcgagcatctg
ctgctggcgttgctcgacgaaccggcgagcgatctcgcgctcgtgctgcgcgcaagcagc
atcgacctgcatgcgttgcgtgcggatatcgagcgcgaattgcagcgcctgaaaagcggt
aatacgcgcacgccggtgttttccaggcatctgatcgatctgctcgaacaggcgtggttg
attgcatcgctcgattcgcagattggacgcattcgctcgggccatttgttgctggcattg
ctgagcgcgccggatctcgcgcagtttgccgagcgcatgtcgccgctctggcgcgacgtg
cgcgtgaccgatctcaagcataagttcgacgaactgacggcgggctcctgcgaagtcgag
cgcagtcaggacgggcaagccgccacggaccgtgccgacgatccggccacgtccgcttcc
atgcccggcacgccgtccagaacacccgcgctcgatacgtacaccagcaacctcacgcag
cgcgcgcgcgaaggcaagatcgaccccgtgatcggccgcgaaggcgagattcgccagact
atcgacattctgatgcggcgccggcagaacaatccgatcatgacgggcgaggcgggcgtc
ggcaagacagcggttgtcgaaggtctggcgctgcgcatcgcggccgacgacgtgcccgcg
ccgctcaagggcgtggcgctgcacgtgctcgacatggggctgttgcaggcaggcgcgagc
gtgaagggcgagttcgaaaaccgcctgaaaagcgtgatcgatgaagtgaagaagagcccg
catccaatcattctgtttatcgacgaagcgcatacgatcatcggcgcgggcggccaggca
ggacagaacgatgcggcaaacctgctcaagcccgcactggctcgcggcgaactgcgcacc
atcgcagcgacgacgtggagcgaatacaagaagtacttcgagaaagacgcggcactcgca
cggcgtttccaggtcgtgaagatcgaagagccgagcgaaacgcttgcggcggccatgttg
cgcggcatggcgtcgttaatggaaaagcacttcaacgtgcgtgtgctcgacgacgcaatc
accgaggcggtgcgcctgtcgcatcgctacattagcgggcggcagctgccggataaggcg
atcagcgtgctcgacaccgcgtgcgcaaaagtggcgctcgcgcatagttcgacaccggcc
gctatcgacgatacgaaaaagcgcctcgagcgcatcgacgcggaaattgccgcgctcgaa
cgcgaggcggcgagcggggcgcagcacgacgaacggctcgcgcaactgcgcgaactccgc
gaggaagacctgcaacacctcgctgaagatgaggcgcgctacgacagggaacgcgcgctc
gtgacggagattgtcgacctgcgtgctgaaatcgacgcggctcgcgtgagcagcgccgac
gcgcagcaggcggagaaagcgcagcaggcgcgtgaaacgctcgcgctgcgggtggccgaa
ttgcaggctttgcagggtactcaaccgatggtgccgttgcaggtggacggacacgtcgtt
gcggaaatcgtggcgtcgtggaccggcattccgctcggccgcatggtcaaggatgaaatc
cagaccgtgttgaatctgcagccgttgctggccgcgcgcgtaatcggccaggaccacgcg
ctcgaagcgatcgcgcagcgcgtgcgcacggcgagcgcgaatctcgaagatccaaacaag
ccgcgcggcgtgttcatgttcgtcggaccttcgggtgtcggcaagaccgaaacggcattg
gcacttgccgatgtgttgtacggcggcgagcgcaagatggtcacgatcaacatgagcgag
taccaggaagcgcacagcgtctcgggtctgaaaggctcgccgcccggctacgtcggttat
ggcgagggcggggtgttgaccgaggcggtgcgccgcaatccgtattcggtggtgctgctc
gacgaggtggaaaaggcgcatcccgatgtactcgaaatgttcttccaggtgttcgacaaa
ggcacgatggacgacgccgaaggccgcgaaatcgacttccgcaatacgctgatcattctc
acgtcgaatgtcggttcgcaagcggtcatgcaggcgtgcctgaacaaaagcgcagaggaa
ctgcccgatgcggacgcgctcgccgaaaccttgcgtccgcaactgtataaggcgttcaag
ccggcttttctcggccgcatgaaagtggtgccgtactatccgatttccgacgatgtgctc
gccgagattatcgaactgaaactggagagaattcgccgccgtatcgagtcgaaccacaag
gcggtatttgagtgggacgagtcgctggtcgatgcggtgcttgcccgctgcacggaagtg
gattcgggcgcgcgcaacgtggaccacattctgaacggtacgctgctgcccgaagtcgcg
cagcatgtgctggagcgcattgcgaacggcgcgacgatcgagcgcatttcggtgcgctcg
agcgaggccggcgaattcgagtacgccgtcgtataa

DBGET integrated database retrieval system