KEGG   Burkholderia sp. CCGE1003: BC1003_5742
Entry
BC1003_5742       CDS       T01314                                 

Definition
(GenBank) type VI secretion-associated protein, ImpA family
  KO
K11902  type VI secretion system protein ImpA
Organism
bgf  Burkholderia sp. CCGE1003
Brite
KEGG Orthology (KO) [BR:bgf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bgf02044]
    BC1003_5742
Secretion system [BR:bgf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BC1003_5742
SSDB
Motif
Pfam: ImpA_N
Other DBs
NCBI-ProteinID: ADN61655
UniProt: E1TGI9
Position
2:2529727..2530845
AA seq 372 aa
MPINLNTLLAPISEAAPCGEDLLFSADFDAIAHARRFEDPSLDQGEWVTEIKEADWPFVI
ERSSALLQTQTKDLRLAVWLTEALAIEEGVTGLTQGYTLITGLCEKYWETVHPLPEGDDT
EYRLGNVAWLVGRTGELLRAMPLTSSQGNVYSTIDWDVAAHVAQAVKRDPDHADDIARGK
PSIEQIDASKRATPAAFYSTLLADLKAFEAAMLALEQELDRRAGDFAPSFRQAKDAYESV
YRLAERFAREVGVHPQAQQTSMSGATAPALQEPERAEPTFKTSLQREEPVLTTTQSQAIA
GIQSRAQAVAQLRAVARFFRSTEPHNPAAYFADKAAEAADMPLHQWLSTVVKDDGSLAHI
RELLGVKPEENS
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgcccatcaatctgaacacgctgctcgctccaatcagcgaagctgcgccctgcggcgaa
gatcttctgttttccgccgacttcgatgccattgcgcacgcacggcgttttgaggaccct
tctctcgatcagggcgaatgggtcaccgaaatcaaggaggccgactggccgttcgtgatt
gaacgttccagtgccttgctgcaaacccagacgaaagacttgcggcttgcggtgtggctc
acggaagcgctcgccattgaagaaggcgtgacgggtctcacgcagggttacacgctgatc
acggggctgtgcgaaaagtactgggaaaccgttcatccgctaccggaaggcgacgacacc
gagtatcgcctcggcaacgtcgcgtggctcgtcggccgcaccggcgagctgctgcgcgcg
atgccgctcacgtcgtcgcagggcaacgtgtacagcacgatcgactgggacgtcgccgcg
cacgtcgcgcaagccgtaaagcgcgatcccgaccatgccgacgacattgcacgcggcaaa
ccctccatcgaacagatcgacgcttcgaagcgcgccacgcctgccgcgttttattcaacg
ttactggctgatctcaaggcattcgaagcagccatgctcgcgctggaacaggagctcgac
cgccgcgctggcgacttcgcgccgagcttccgccaggcgaaggacgcctacgaaagcgtc
tatcgtcttgccgaacgcttcgcgcgggaagtcggcgtgcatccgcaggcacaacagacg
tccatgagtggtgcaactgcaccggcgttgcaggaacccgagcgcgccgagcccactttc
aagacatcactgcaacgcgaggaacctgtgttgacgaccacgcaaagccaggcaatcgca
ggaatccagagtcgcgcgcaagccgtcgcgcagttgcgcgcagtggcccgcttctttcgc
agcaccgagccgcacaatcccgctgcatacttcgccgacaaagccgcggaggccgccgac
atgcccttgcatcagtggctttccacagtggtgaaagacgacggatcgctcgcgcatatc
cgcgagttgctgggtgtgaagccggaagaaaacagctag

DBGET integrated database retrieval system