KEGG   Burkholderia sp. CCGE1003: BC1003_5745
Entry
BC1003_5745       CDS       T01314                                 

Definition
(GenBank) type VI secretion protein IcmF
  KO
K11891  type VI secretion system protein ImpL
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
bgf03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bgf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BC1003_5745
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bgf02044]
    BC1003_5745
Secretion system [BR:bgf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BC1003_5745
SSDB
Motif
Pfam: IcmF-related IcmF-related_N IcmF_C DUF4229 DUF4381
Other DBs
NCBI-ProteinID: ADN61658
UniProt: E1TGJ2
Position
2:complement(2532946..2536860)
AA seq 1304 aa
MRRFLNVLTHPRTLSIIGLLALAAVLFVGADTLQIDPKWPALVLAVVVALWLLVWVVRRL
RARRANNRLGEMLEQQAEKQSAEAGPAPTPARQAELDVLRTRLVDAVRTIKTSKIGQLSG
GSALYELPWYIVIGNPAAGKSSAVLNSGLQFPFADKNNAVIHGIGGTRNCDWFFTTEGIL
LDTAGRYSVHEEDRTEWLGFLGLLKRFRPKAPINGIIVTASIAELTSSKPEFAINLAKNL
RQRVQELTEKLEVFAPVYVMFTKADLITGFTEFFSGSDRHEYDRVWGATLPYEPDEKRDV
VGLFDEHFEELYDGLKEISVAQMSINRGNKLSPGQLSFPLEFSTIKPALRAFLATLFETN
PFQYKPIFRGFYFTSALQEGETNSAAATRIANRFGLSAESMPKPHSAFSKNGFFLRDLFS
KVIFADRQTVRQFASPAKTRLRYATFFGFVAVLALALGGWTWSTINNQQLAENVKADLDN
VVRLQQNRNDLQSRLQAMDVLEDRIDQLEQFRRDKPLAVSFGLYQGDRLEQRLLTEYYNG
VRQILLDPVSQNLAAFLKEVDAHPDQLAPLNRTPDAAAVPVSAHNAMAANGQGGLYSDAS
PTNVEDAYNALKTYLMLSDKRHVETAHLTDQVARFWRGWLETNRGNMPRDEMIRSAERMI
TFYLSRVSDDDWPMIDQNLGLVDQTRENLRRVVRGMPARQRVYEEIKARASTRFAPMTIA
RIVGENNTGLVAGSYAIPGTFTREAWFQYVQPAIREAATKELQAKDWVLNTSAHDDLTLE
GSPEQIQKALVTMYKTEYAMHWQKFMQGIAVQSFGSFGQAVDAMNRLGDPQDSPIRKVLE
TAYDQTSWDNPSLFNASLKRAQSGVTSWFKQWFSRAPTGQLNANIDINGNPVEMPMGPIG
QEFSALGRIVVTGDNGSMLKGYMDTLSKVRTRFNVIKNQGDPGPGARQLMQQTLDGSGSE
LADSLKYVDEQMLTGLTDSQRKALRPLLVRPLMAAYAVVIQPASVEVNKVWNAQVYQTFQ
SSLANKYPFASDAKVEAGAGEIAQVFGPDGSIAKFVGTTLGPLAVRRGDTLTARTWGDMG
LALTPDFTNGFARWVAPLAGGAAGASAGQSSAEPQTVFQILPQPSSGTTEYTLAIDGQQM
RYRNTPPQWTNFVWPNPSGSPGATLSATTFDGRTLQLVNEPGRYGLEKLINSAQRKRRPD
GTFDLSWTQGNVTVAVSMRIISTSQASGGSSDAPQQQSLRGLRLPSSVADVSAAGNSVVA
TNTATSAATSAAAGAAPITPSSTPPTAPAARPATAAVSTQGGAQ
NT seq 3915 nt   +upstreamnt  +downstreamnt
atgcgacgcttcctcaacgtgttgacccatccacgcacgctctcgatcatcggcctgctc
gcgctcgcggctgtgttgttcgtcggcgccgatacattgcagatcgatccgaagtggcca
gccctcgtgcttgccgtggtggtcgcgctgtggctgctggtatgggtggtgcgccgcctg
cgcgcgcgtcgcgcgaacaacaggcttggcgaaatgctcgagcagcaggcggaaaaacaa
agcgcggaagcggggcccgcccccacgccggcacgccaggcagagctcgacgtgctgcgc
acgcgtctggtcgacgcggtgagaacgatcaagacctcgaagatcggtcagctatcgggg
ggctcggcattgtacgagttgccctggtacatcgtgattggcaatcccgctgcgggcaag
agcagcgccgtgctgaattcgggcctgcaatttccgttcgccgacaagaacaacgccgtg
attcacggcattggcggcacgcgcaattgcgactggttcttcacgactgaaggcattctg
ctggacacggccggccgctactccgtgcatgaagaagaccgtaccgaatggctcggcttt
ctcggcctgctcaaacgcttcaggcccaaagcgccgatcaacggcatcatcgtgaccgcg
agcattgcggaactcaccagtagcaagcctgaattcgccatcaatctggcgaagaacctg
cgccagcgcgtgcaggaattgaccgagaaactggaagtcttcgcgccggtctacgtgatg
ttcacgaaagccgatctgatcaccggctttacggagttcttcagcggtagcgaccgtcac
gaatacgaccgcgtgtggggcgccaccctgccctacgagcccgacgagaagcgcgacgtg
gtgggcctgttcgacgagcatttcgaagagctctacgacggcctcaaagaaatcagcgtc
gcgcagatgtccatcaatcgcggcaacaagctctcgccgggccaattgagcttcccgcta
gagttctcgaccatcaagcccgcgctgcgcgcgttccttgccacgctgtttgaaacgaac
ccgttccagtacaagccgatctttcgcggcttctatttcacgagcgcattgcaggaaggc
gaaaccaatagcgccgccgccacccgcatcgccaaccgtttcggcctgagcgccgagagc
atgcccaagccgcacagcgcattttccaagaacggcttcttcctgcgcgacctcttttcc
aaggtcatcttcgcggaccgtcaaacggtcaggcaattcgcgagcccggccaaaacgcgc
ctgcgctatgcgaccttcttcggctttgttgcggtgctggcgctcgcgctggggggctgg
acgtggtcgactatcaacaaccagcaactggcggagaacgtcaaggcggatctcgacaac
gtcgtgcgtttgcagcagaaccgcaacgacctgcaatcgcgtcttcaggccatggatgtt
cttgaagaccgtatcgatcagctcgaacagttccgccgcgacaagccgcttgccgtttcg
ttcggcctctatcagggcgatcgcctcgagcagcgtcttcttaccgagtactacaacgga
gtgcgccagatcctgctcgatccggtttcgcagaacctcgcggcgttcctgaaggaagtc
gacgcgcatcccgatcaactcgcgccgctgaaccgcacgccggatgcggcagccgtgccg
gtctccgcgcacaacgccatggccgccaacggccagggcgggctttatagcgacgcttcg
cccaccaacgtggaagacgcgtacaacgcgctcaagacctacctgatgctgagcgacaag
cgtcacgtcgaaacggctcacctgactgatcaggtggcgcgcttctggcgcggctggctt
gaaacgaatcgcggcaacatgcctcgcgacgaaatgatccgcagcgccgagcgcatgatc
acgttctacctgtcacgcgtatccgacgacgactggccgatgatcgaccagaacctcggt
ctggtcgatcagacccgcgaaaacctgcgccgcgtggtgcgcggcatgccggcgcgtcag
cgtgtctatgaagagatcaaggcgcgcgcgtcgacccgctttgcaccgatgaccattgcg
cggattgtcggcgaaaacaatacggggctggtggcgggcagctatgcaattcccggcacg
ttcacgcgcgaagcatggttccagtacgtgcagcccgccattcgcgaggccgcgaccaag
gaattgcaggcaaaggattgggtgctcaacacgtccgcgcacgacgacctgacgctcgag
ggcagccccgagcagattcagaaagcgctcgtcaccatgtacaagaccgagtatgcaatg
cactggcagaagttcatgcaaggcattgcggtgcagagcttcggcagcttcggccaggcg
gtggatgcgatgaaccgccttggcgacccgcaagattcgccgattcgcaaagtactcgaa
accgcgtatgaccagacctcgtgggacaacccttcgctctttaacgcaagcctgaaacgc
gcgcaaagcggcgtgacgagctggttcaagcaatggttctcgcgtgcgccgaccggtcag
ttgaacgccaacatcgacatcaacggcaatccggtggaaatgccgatgggacccattggg
caggagttctccgcgctcggccggatcgtcgtgacgggcgacaacggctcgatgctcaag
ggctatatggacacgctctcgaaggtccgcacgcgctttaacgtcatcaagaatcagggc
gatccgggtccgggcgcgcgccagctcatgcagcagacactcgacggcagcggctccgaa
ctcgccgattcgctcaaatacgtcgacgagcagatgctcacgggcctcaccgattcgcaa
cgcaaggcgctgcgtccgctgctcgtgcgcccgctgatggccgcgtatgcggtggtgatc
cagccggccagcgtcgaagtgaacaaggtctggaacgcgcaggtgtaccagacgttccag
agctcgctcgcaaacaagtatccgttcgcgagcgatgccaaggtcgaggccggcgcgggc
gaaatagcgcaggtgttcggcccggacggctcgattgcgaagttcgtcggcaccacgctc
gggccgcttgcggtgcgccgtggcgacacgctgactgcgcgcacctggggcgacatgggc
ctcgcgctcacacccgacttcaccaacgggttcgcacgttgggtcgcgccgctcgccggc
ggcgcagcgggcgcgtcggcgggccagagctcggcggaaccgcagacggtgttccagatc
ctgccgcagccgagcagcggcacgaccgagtacacgctcgccatcgacggccagcagatg
cgctatcgcaacacgccgccgcaatggaccaacttcgtgtggccgaacccgtcgggctcg
ccaggcgccacgttgtccgcaacgaccttcgacggccgcactctgcagctcgtcaacgag
ccgggccgctatgggctcgagaaactgatcaactcggcgcagcgcaagcgtcgccccgac
ggcaccttcgatctgtcgtggacgcaaggcaacgtgacggtggccgtcagcatgcggatc
atcagcacgtcgcaagcatcgggcggcagcagcgacgcgccgcagcagcagagcctgcgc
ggcttgcgtctgccttcgtcggtggcggacgtcagcgcggcgggcaattcggtggtcgcc
actaacacggccacgagcgcggcgaccagcgcggccgccggcgcggcacccatcacgccg
agctcgacacccccgacggcgccggcggcgcgccccgccacggcagctgtttcgacccaa
ggaggcgcgcaatga

DBGET integrated database retrieval system