KEGG   Burkholderia sp. CCGE1003: BC1003_5763
Entry
BC1003_5763       CDS       T01314                                 

Definition
(GenBank) type VI secretion system Vgr family protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
bgf03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bgf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BC1003_5763
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bgf02044]
    BC1003_5763
Secretion system [BR:bgf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BC1003_5763
SSDB
Motif
Pfam: Phage_GPD Phage_base_V Lipase_3
Other DBs
NCBI-ProteinID: ADN61676
UniProt: E1TGL0
Position
2:2558371..2561553
AA seq 1060 aa
MCLSQSIGRLPNLVLINQSDQPTTFNVFVTLFSLKIPAGSFWESNVSVIFRLRKSAKNKI
GICRAGGIMSFNNASDGISGSGGSVAGVLGSAGSLAGLASNVGAISPSAAGVVNQAARAA
QLAQTASSLIGKTPAAVADAINTLASKPVLTQQNRFMSIRTPLGPDVLLVTALVADEYLN
QLSEIHLDLISQKRDIPIDSLVGQVVSVSLTAERSGVVSALSAKGNAATERYFHGFVISF
SRVGNSGTVTRYEMTVVPWLWFLTRSTDCRIFQDKTPPDILTEIFSEFGFTDFELNLQGT
YKPFEYIVMYRESYFNFVARLMEQEGIIWWVRHEKDRHVLVITDSNAGFRGIDDLTEIPF
YADSAASEKNGISQWNEAFSFRVGKITYRDFNHRTPSTPLLHVEVPSTLRNPNIQNTERY
EYHSLYDHGEDGERYARFAMEAEEAQAHHFNGASYVQKLAPGLKFKLVNHPVSAYNNKDF
VLLHVRHEAANDYTHESNEFPYRNSFSCLPMDIPYRPERRTPKPYMYGTQSAVVVGPKGA
EVHTDGSSVKVHFFWDRRGRQDGSDSMWVRVAQSWAGGGWGGSAMPRTGQEVLVAFNEGD
PDNPIIVGRVFNGEKANPYHDTAGRTMGFRSKTINGDGFNELKFSDVAGSEEVFVHAQKD
LNAVIKDSETRSIEGGNRLVRLHAGDETKDIAKGSLTETIAKARATTANTIDTKAVGGEA
GPGNQTHQATDQIEHRVGSSIITMKPDSIKLSHGASSILINQSGIFLDGPVIHLNQGLFV
TPDQALAIQWAQQQAIIAAGLASPDPKVRDAAKRLQASVKAQQMAKLADAVYSPGTAPPG
WSNISNDPEALKKFGLRPADLSIPGSNFGAQAYAPDPAVFGDSMKPTVAFKGTEQLTGED
MSNNIAQGQGHESAYYGRAVKIGKTVQASGNASDLDLTGHSLGGGLASAAAEASGSSATT
FNAAGLNSGTLSLYGATPVRASITNYRVDGDILTGLQEGKLGPISDATASVMPKAVGEQI
DIPGSAMTTLSRHKMAQVNAGMESTVADQQSSLLQILGSH
NT seq 3183 nt   +upstreamnt  +downstreamnt
ttgtgcctaagccagtcgataggccggctgccgaatctcgtcttaatcaatcaatcggat
cagccgacgacatttaacgtttttgttacactcttctcgctaaaaattcccgcgggtagt
ttttgggaatcaaatgttagcgtaatattccgcctgcgcaaaagcgccaagaacaaaatc
ggcatttgccgcgctgggggcattatgagtttcaataacgcaagcgatgggatatctggc
agcggaggctctgttgccggggtattggggagtgcgggatcgctcgcaggactcgcgagc
aatgtgggcgccatcagcccctcggctgccggcgtggtcaaccaggcggcgcgcgcggct
caattagctcagacggcatccagcctgatcggcaagacgcctgccgcggttgccgacgca
atcaatacgctggcaagcaagcccgttctcactcaacaaaaccggttcatgtccatccgg
acgccgctcgggccggacgtgttgttggtaacggcgctcgttgcggacgaatacctcaat
caactgtctgagattcatctcgaccttatctcccaaaaacgtgacattccgattgattcg
ctagtgggccaggtcgtttcagtctcactaaccgctgagcggtccggcgtggtgtcggcg
ctgtccgcaaagggcaacgctgcgacggagcgttattttcacggtttcgtaatttccttc
tcgagagtcggaaattccggcacggtaacccgatatgaaatgacggtcgttccgtggtta
tggtttttgacacgctcgacggactgcaggattttccaagataagacgccgcccgatatt
ttgacggaaatattttccgagttcggctttaccgacttcgagctgaatcttcaggggacc
tataagccctttgagtacattgtcatgtatcgggagtcgtacttcaatttcgttgcccgg
ctgatggagcaggaaggcatcatctggtgggttcgccatgagaaggacaggcatgtcctc
gtgataacggacagtaatgctggctttcgcggcatcgatgatttgacggagattccgttc
tacgcggacagtgctgccagcgagaagaacggcatatcacaatggaacgaggcgttcagt
ttccgcgtcggcaaaatcacctatcgcgatttcaaccatcgtacgccgtctacgccgctc
cttcatgtcgaggtgccgtccactctccgaaatccgaacattcagaacaccgagagatac
gaatatcattcgctatacgatcacggcgaggacggtgaacgttacgcacgtttcgcaatg
gaagcggaggaggcgcaagcccatcatttcaatggagcgtcgtacgttcagaagcttgcc
ccgggcttgaagttcaagctcgttaatcaccccgtgtctgcgtacaacaacaaggacttc
gtacttcttcacgtgcggcacgaagccgctaacgattacacccacgagtcgaacgagttt
ccataccggaattcgttctcttgcctgccgatggacatcccttatcggccggagcgtcgc
acgccaaagccttacatgtacggcacccagtcggcggtagtcgtcggcccgaaaggtgcc
gaggtccacaccgacggcagctcggtgaaggtgcattttttctgggaccgccgcggcagg
caggatggcagcgactcaatgtgggtgcgtgtggcccagtcatgggccggcggaggctgg
ggcggctcggcgatgccgcgcacggggcaggaggtacttgtagcatttaacgagggggac
ccggacaatcccatcatcgtgggccgagtgttcaacggcgagaaagcgaacccataccac
gacacggctggccgaaccatggggtttcgcagcaagacgataaacggcgacggattcaac
gaactgaagttttcggatgtcgcgggctcggaagaggttttcgtccatgcacaaaaggac
ctgaatgccgttatcaaggatagtgaaacccgctctatcgaaggcggcaaccggctcgtg
cggctgcacgccggcgatgaaacgaaagacattgccaaaggcagcttgacggagacaatc
gcaaaggcgcgcgcgacgacggctaatacgatcgataccaaagcggtcggcggtgaggct
gggcctggcaaccagacgcatcaggcaacagaccagatagagcatcgcgtgggctcgagc
atcatcacgatgaagcccgacagtatcaagctgtcgcacggcgcgtcgagcatcctgatc
aaccagagcggaattttccttgacggaccggtaatccacctgaatcagggcctgttcgtg
acgccggatcaggcgttggccattcagtgggcacagcagcaggcgatcatcgcggcgggc
ctggcgagccccgatcctaaggtgcgcgacgccgcaaagcggctgcaggcatctgtgaag
gcgcagcagatggcgaagctcgcggacgcagtgtattcgccaggtaccgcgccgcccgga
tggtcgaacatcagcaacgatcctgaggctttgaagaaattcggcctacggccggcagat
ctgtccataccgggaagcaacttcggggcacaggcgtatgcgcctgaccccgctgtgttc
ggcgacagcatgaagccaacggtggcgttcaaaggtaccgaacagctgacgggtgaggac
atgtcgaataacatcgcacaaggtcagggccacgagtccgcctattacgggcgggcagta
aaaataggcaagaccgtgcaagcctcgggcaatgcttcggatcttgacctcacgggtcac
tcgctcggtggtggcctcgcgtcagcggccgcagaggcaagcgggtcgagcgcaacgacc
tttaacgccgcgggattgaattccgggacactctcactgtacggagcgacaccggtccgc
gcttcgataaccaattaccgcgtcgacggcgacatcctgactggattgcaggaagggaaa
cttggtccgatcagtgacgccacagcgtcagtcatgccaaaggctgtgggcgagcagatc
gatatcccgggcagcgcgatgacgacgctgtcccgccacaagatggcgcaggtcaatgct
ggaatggaatcaacggttgcagaccaacagtcgtcgctgcttcagattctaggatcgcac
taa

DBGET integrated database retrieval system