KEGG   Brachybacterium ginsengisoli: CFK41_08815Help
Entry
CFK41_08815       CDS       T05099                                 

Definition
(GenBank) glycogen synthase
  KO
K16148  alpha-maltose-1-phosphate synthase [EC:2.4.1.342]
Organism
bgg  Brachybacterium ginsengisoli
Pathway
bgg00500  Starch and sucrose metabolism
bgg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CFK41_08815
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bgg01003]
    CFK41_08815
Enzymes [BR:bgg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.342  alpha-maltose-1-phosphate synthase
     CFK41_08815
Glycosyltransferases [BR:bgg01003]
 Polysaccharide
  Storage polysaccharide
   CFK41_08815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_1 Glyco_transf_4 Glyco_trans_1_4 Glyco_trans_4_4 Glyco_trans_1_2 Glyco_transf_5
Motif
Other DBs
NCBI-ProteinID: ATG54855
UniProt: A0A291GXB4
Position
1977831..1979024
Genome map
AA seq 397 aa AA seqDB search
MRVDLLTKEYPPEIYGGAGVHVAELTKVLRPHAEVRVRAFGADREEEGTFSYSTPVELEG
ANAALSTLGTDLLIAADCAGADLIHSHTWYANFAGHMASLLHGAPHVLSAHSLEPLRPWK
AEQLGGGYAVSSFAERTAYEGAAGIIAVSAGMREDILRAYPSVDPAKVHVVHNGIDIEQW
SPNPETSALTSRGIDPEAPTIAFVGRITRQKGLPYFLRAVRDLPADIQVVLCAGAPDTPE
IAQEVNSLVEELATTRGNVHLITEMLPRHELTQILTHATAFACPSIYEPLGIVNLEAMAC
GTPVVASATGGIPEVVADGETGYLVPLEQLTDGTGTPVDPEKFIADTRDALVRMVSDPER
ARQMGEASRRRAAEHFSWTSIAERTLEVYRTVIAQHS
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtcgatctgctcaccaaggagtacccgccggagatctacggcggtgccggggtc
catgtcgccgagctgaccaaggtgctgcgaccgcacgcggaggtgcgggtgcgcgccttc
ggagcggaccgcgaggaggaggggaccttctcctactccacgcccgtcgagctcgagggc
gccaacgcggcgctgtccaccctgggcacggacctgctgatcgccgccgactgcgccggc
gcggacctgatccactcccacacctggtacgcgaacttcgccgggcacatggcctcgctg
ctgcacggagcgccccacgtgctctcggcccactcgctggagccgctgcgtccgtggaag
gcggagcagctcggcggcggctacgcggtcagctccttcgccgagcgcaccgcctacgag
ggcgccgcaggcatcatcgcggtctccgccgggatgcgcgaggacatcctgcgggcctac
ccctcggtcgatccggcgaaggtccacgtggtgcacaacggcatcgacatcgagcagtgg
tcgccgaacccggagacctcggccctgacctcccggggcatcgatcccgaggcacccacg
atcgcgttcgtcggccgcatcacccgccagaaggggctgccgtacttcctgcgcgcggtg
cgcgacctgcccgccgacatccaagtggtgctgtgcgccggcgcccccgacaccccggag
atcgcccaggaggtgaactcgctggtcgaggaactcgccacgacccgcggcaacgtgcac
ctgatcaccgagatgctgccgcgccatgagctcacccagatcctcacccacgccaccgcg
ttcgcctgccccagcatctacgagccgctcggcatcgtaaacctcgaggcgatggcctgc
ggcacccccgtggtcgcttcggccaccggtgggatcccggaggtcgtggccgacggggag
accggctacctggtccccctcgagcagctcaccgacggcaccggcaccccggtggacccg
gagaagttcatcgccgacacccgcgacgcgctggtgcggatggtctcggacccggagcgg
gcacggcagatgggggaggcctcccgacgccgtgcggcggagcacttctcctggacctcc
atcgccgagcgcaccctcgaggtctaccgcacggtgatcgcccagcactcctga

DBGET integrated database retrieval system