KEGG   Brachybacterium ginsengisoli: CFK41_16625Help
Entry
CFK41_16625       CDS       T05099                                 

Gene name
dhaL
Definition
(GenBank) dihydroxyacetone kinase subunit L
  KO
K05879  phosphoenolpyruvate---glycerone phosphotransferase subunit DhaL [EC:2.7.1.121]
Organism
bgg  Brachybacterium ginsengisoli
Pathway
bgg00561  Glycerolipid metabolism
bgg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    CFK41_16625 (dhaL)
Enzymes [BR:bgg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.121  phosphoenolpyruvate---glycerone phosphotransferase
     CFK41_16625 (dhaL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dak2
Motif
Other DBs
NCBI-ProteinID: ATG56220
UniProt: A0A291H1F7
Position
complement(3722974..3723648)
Genome map
AA seq 224 aa AA seqDB search
MTDTSTQPLPEGLGSDFITGLHATLSGAADALGDLDRRAGDGDFGTNVRTAMKLATGNLE
ADAPTTYRQWVSAMSMAWLGVGGTSGPLFGMFFRDLAKAGEEGAVPTLAQLADALAAGQA
VVQKYGEAEVGDKTMIDSLAPAIAALREAIEAGAEPAAALADAERAAVEAARATADSTAR
RGRASYVGEVSKGVIDPGAAAMALVIGAARAAVDGGEVETGWIS
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacacctccacccagcctctgcccgagggcctcggcagcgacttcatcaccggc
ctccacgcgaccctctccggcgcggccgacgccctcggggatctcgaccgccgcgccggc
gacggcgacttcggcaccaatgtccgcaccgccatgaagctcgccaccggcaacctcgag
gcggacgcccccaccacctaccgccagtgggtgagcgcgatgtccatggcgtggctcggc
gtgggcggcaccagcgggccgctgttcggcatgttcttccgcgacctcgccaaggcgggg
gaggagggcgccgtccccaccctcgcccagctcgccgacgccctcgccgccgggcaggcc
gtcgtgcagaagtacggcgaggcggaggtgggggacaagacgatgatcgactccctcgcc
ccggccatcgcggccctccgcgaggcgatcgaggcaggggccgagcccgccgccgccctc
gcggacgcggaacgggccgccgtcgaggccgcccgcgccaccgcggacagcaccgcccgg
cgtggtcgcgccagctacgtgggcgaggtgtccaagggcgtcatcgaccccggagccgca
gcgatggccctggtcatcggtgctgcgcgggccgccgtcgacggcggcgaggtggagacc
ggctggatctcctga

DBGET integrated database retrieval system