KEGG   Brachybacterium ginsengisoli: CFK41_16630Help
Entry
CFK41_16630       CDS       T05099                                 

Definition
(GenBank) dihydroxyacetone kinase subunit DhaK
  KO
K05878  phosphoenolpyruvate---glycerone phosphotransferase subunit DhaK [EC:2.7.1.121]
Organism
bgg  Brachybacterium ginsengisoli
Pathway
bgg00561  Glycerolipid metabolism
bgg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    CFK41_16630
Enzymes [BR:bgg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.121  phosphoenolpyruvate---glycerone phosphotransferase
     CFK41_16630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dak1
Motif
Other DBs
NCBI-ProteinID: ATG56221
UniProt: A0A291H179
Position
complement(3723659..3724657)
Genome map
AA seq 332 aa AA seqDB search
MRRSIVNDPEDLVPEALEGLVLSHPLLLELNQEHRYVTRRTRAQDKVGLVSGGGSGHEPL
HAGFVGTGMLDVAVAGAVFASPTALQVLEATKAADAGRGVVQIVKNYTGDVLNFRIAGEI
SGDDAIDTEIVLVDDDLATDTEDGTGPGRRGTAATVIVEKLCGAAAEAGASLSEVAAIGR
RAASRARTMSLALSAGTHPGDSEPQFTLADDEIELGVGIHGERGRGRVPFTSADGLTDLL
LDPLREELSLQRGEEVLAIVNGLGGTYPLELNLVARALHHRLADRGIAIERSLVGSYVTS
LDMHGVSITLMPLDDEARSLWDAPVRTPALTW
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgcagcatcgtcaacgatcccgaggacctggtccccgaggccctcgagggcctc
gtgctcagccacccgctgctgctcgagctgaatcaggagcaccgctacgtcacccgccgc
acgcgcgcgcaggacaaggtgggcctggtctccggcggagggtccgggcacgagccgctg
cacgccggcttcgtgggcaccggcatgctcgacgtcgcggtcgccggcgccgtcttcgcc
agccccaccgccctgcaggtcctcgaggccaccaaagcggccgacgcgggccgcggtgtg
gtccagatcgtcaagaactacaccggcgatgtgctgaacttccgcatcgccggggagatc
agcggcgacgacgccatcgacaccgagatcgtgctcgtggacgacgacctcgccaccgac
accgaggacggcaccgggccgggccgccgcggcacggccgcgaccgtcatcgtcgagaag
ctctgcggcgccgccgccgaggccggggcgagcctctccgaggtcgccgccatcggtcgt
cgggccgcctcccgcgcccgcaccatgagcctcgcgctctccgccggcacccatcccggg
gactccgagccccagttcacgctcgccgacgacgagatcgagctgggcgtgggcatccac
ggggagcgcggccgcggccgcgtccccttcacctcggccgacggcctgaccgacctgctg
ctggacccgctgcgggaggagctctcgctgcagcgcggcgaggaggtgctcgcgatcgtg
aacgggctcggcggcacctacccgctggagctgaacctcgtggcccgggccctgcaccat
cgcctcgcggaccgcggcatcgcgatcgagcgatccctcgtcggctcctacgtcaccagc
ctcgacatgcacggcgtctcgatcacgctgatgccgctggacgacgaggcccgctcgctg
tgggacgcccccgtccgcacccccgccctgacctggtaa

DBGET integrated database retrieval system