KEGG   Blastomyces gilchristii: BDBG_05014
Entry
BDBG_05014        CDS       T06540                                 

Definition
(RefSeq) delta14-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
bgh  Blastomyces gilchristii
Pathway
bgh00100  Steroid biosynthesis
bgh01100  Metabolic pathways
bgh01110  Biosynthesis of secondary metabolites
Module
bgh_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:bgh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    BDBG_05014
Enzymes [BR:bgh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     BDBG_05014
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 Ferlin_C
Other DBs
NCBI-GeneID: 8504668
NCBI-ProteinID: XP_002625150
UniProt: A0A179ULV0
Position
Unknown
AA seq 509 aa
MGAKTEKKAAEKKSAGKAAPALSPSAAFEKHGYEFFGPPGTFILITVLPILIYIFPFVCN
DISGCPAPSLLSPSTLVLGTLKREVGWPEDGLKGLYDTQTTLYVLGYYLLLLVLQIVLPG
REVDGVVLASGGRHKYKFNTLLSTILILGGCGAGSYVYGADFPVWTFIWDNYIQIITANI
IISVAFSLFVYLRSFTVPAPGQPNPTHRELAPGGCSGNPIYDFFMGRELNPRITLPIPFV
SEASRIFDIKVFCEMRPGLLGWIILNLANIAHQYKVNSGEITISILLVTFFQAFYVIDSF
FMEPAILTTMDVIMDGFGFMLSFGDLVWVPFIFSIQTRYLAVYPLHVGPQGIAMVLGVQA
VGYYVFRSTNNQKNRFRTNPNDPRVKHLKYIETAAGSRLLISGWWGCARHINYLGDWVMS
WAYCLPTGVAGYLMLDHVDPVTGAVEKRAVQTPEVRGWGIPVTYFFMVYFTILLLHRERR
DEAKCRRKYGKDWDRYTSIVKSRIVPGIY
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgggcgcaaaaaccgaaaagaaagctgcagaaaagaagtctgctggaaaggcagcacca
gcgctctctccctcagctgcatttgaaaagcatggatatgagttttttggacccccgggg
acgtttatcctaatcaccgtccttccgattctcatctacatattccccttcgtctgcaac
gatatctccgggtgcccagcaccatccctcctcagcccttctacccttgtgctgggcacc
ttaaaacgagaagttggatggcctgaggatggcctgaagggcctgtacgatacccagacc
accctctatgtccttggttactacctgctccttctggttctccaaattgtgctgccaggg
agagaggtcgacggagtagtactggcatctggaggaagacacaaatataagttcaacacc
cttctttccacaattttgatcctgggaggatgcggtgcaggaagttatgtatacggggcc
gatttccccgtatggactttcatttgggacaactacattcaaatcatcaccgcaaacatc
attatctccgtggcattctcgcttttcgtctaccttcgaagcttcacagttcccgctccg
ggacagcccaacccaacacaccgcgaacttgcacctggaggctgcagtggcaatccaatt
tacgatttcttcatgggccgtgaactcaacccgcgaatcacccttcccatccccttcgtg
agcgaagcgtcaagaatatttgacatcaaagttttctgtgagatgcgacctggtcttttg
gggtggatcattttgaatctagccaacatcgcacatcagtacaaggtcaactctggtgag
attacgatatcgatactactcgttactttcttccaggctttctatgtgattgacagcttc
ttcatggaacctgctatcctcacaaccatggacgtgatcatggatgggttcggattcatg
ttgtcatttggcgatttggtctgggtgccattcattttctcgatacaaacaagatacctc
gccgtgtaccctctgcatgttggcccacagggcattgcaatggtgttgggagttcaagcg
gtcggatattatgtcttccgcagcacgaacaaccagaagaacagattccgcacgaaccct
aatgaccctcgagtcaagcacctgaagtatattgaaactgcagctggttcccgcctgctg
atatccggctggtggggttgtgctcgtcatatcaactacctaggcgattgggtgatgtca
tgggcatactgccttcccactggtgttgcgggttatctcatgctcgaccacgtggatcca
gttacaggggctgtggaaaaacgcgcagtccagacccccgaggttcgtggctggggtatt
ccagtaacgtacttcttcatggtgtatttcactattcttctcctccaccgggaaagaaga
gacgaggcgaagtgcagaaggaagtatggcaaggattgggataggtatacttccattgtg
aaaagtaggattgtaccagggatctattaa

DBGET integrated database retrieval system