KEGG   Bacillus gibsonii: BGM20_07375Help
Entry
BGM20_07375       CDS       T04820                                 

Definition
(GenBank) glutathione-dependent formaldehyde dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
bgi  Bacillus gibsonii
Pathway
bgi00010  Glycolysis / Gluconeogenesis
bgi00071  Fatty acid degradation
bgi00350  Tyrosine metabolism
bgi00625  Chloroalkane and chloroalkene degradation
bgi00626  Naphthalene degradation
bgi00680  Methane metabolism
bgi01100  Metabolic pathways
bgi01110  Biosynthesis of secondary metabolites
bgi01120  Microbial metabolism in diverse environments
bgi01130  Biosynthesis of antibiotics
bgi01200  Carbon metabolism
bgi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BGM20_07375
  09102 Energy metabolism
   00680 Methane metabolism
    BGM20_07375
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BGM20_07375
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    BGM20_07375
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BGM20_07375
   00626 Naphthalene degradation
    BGM20_07375
Enzymes [BR:bgi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BGM20_07375
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     BGM20_07375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_N_assoc ADH_zinc_N FtsJ Glu_dehyd_C AlaDh_PNT_C Sacchrp_dh_NADP Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: AOL30459
Position
1410363..1411499
Genome map
AA seq 378 aa AA seqDB search
MKAVTYQGIKNVVVKDVPDPKIEKSDDMIIKVTSTAICGSDLHLIHGFIPNMQEDYVIGH
EPMGIVEEVGSGVTKLKKGDRVIIPFNIACGECFFCKNQLESQCDQSNDNGEMGAYFGYS
GQTGGYPGGQAEYLRVPFANFTHFKIPESCEEPDEKLSVIADAMTTGFWSVDNAGVKKGD
TVIVLGCGPVGLFAQKFCWLKGAKRVIAVDYVNYRLQHAKRTNKVEIVNFEDHENTGNYL
KEITKGGADVVIDAVGMDGKMSDLEFLASGLKLHGGTMSALVIASQAVRKGGTIQITGVY
GGRYNGFPLGDIMQRNVNIRSGQAPVIHYMPYMFELVSTGKIDPGDVVSHVLPLSEAKHG
YDIFDSKMDDCIKVVLKP
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagtaacgtatcaaggcattaaaaatgttgttgtcaaagatgtccccgatcca
aagattgaaaaatccgatgacatgattatcaaagtcaccagtacagccatttgcggatca
gatttacatttaatccatggattcattccgaatatgcaagaagactatgtcatcggccat
gaaccgatgggaatcgtcgaagaagttggttctggggtgactaaactaaaaaagggagat
cgggtaattattccctttaatatagcatgcggggaatgctttttttgtaaaaaccagctg
gaaagccaatgtgatcagtctaatgacaatggggaaatgggtgcttatttcggctattca
gggcaaactggcggttatccaggcgggcaagctgaatatttaagagtgccgtttgcgaat
tttacccattttaaaatccctgaatcttgtgaggaacccgatgagaaattaagcgtgatt
gccgatgccatgaccaccggcttttggagtgtggacaatgccggcgtaaaaaaaggcgat
acagttatcgttctcggctgcggaccagtcggcctgtttgctcaaaagttttgttggcta
aaaggcgcaaaacgcgtcatagcagtagactatgtaaactatcgcttacagcatgcgaaa
cgtacaaacaaagtagaaatcgttaattttgaagaccatgagaatacagggaattattta
aaggaaatcacgaaaggcggagcggatgtagtcattgacgctgttgggatggatggtaaa
atgagcgatctcgagttccttgccagcggcttaaagcttcatggcggaacgatgagtgca
ttggtcattgcttcccaagctgttcgcaaaggaggaaccatacaaattacaggtgtgtat
ggaggcagatataacggttttccgttaggagatattatgcagcgaaacgtcaatatacgc
tctggacaggctcctgtgatccactatatgccgtacatgtttgaactagtatcgacaggc
aaaattgatccgggagatgttgtcagccatgtcctgccgcttagtgaagccaagcatggc
tatgacatttttgattcaaaaatggatgattgtatcaaagttgtgttaaagccttaa

DBGET integrated database retrieval system