KEGG   Bacillus gibsonii: BGM20_14325Help
Entry
BGM20_14325       CDS       T04820                                 

Definition
(GenBank) fructose 1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
bgi  Bacillus gibsonii
Pathway
bgi00010  Glycolysis / Gluconeogenesis
bgi00030  Pentose phosphate pathway
bgi00051  Fructose and mannose metabolism
bgi00680  Methane metabolism
bgi01100  Metabolic pathways
bgi01110  Biosynthesis of secondary metabolites
bgi01120  Microbial metabolism in diverse environments
bgi01130  Biosynthesis of antibiotics
bgi01200  Carbon metabolism
Module
bgi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BGM20_14325
   00030 Pentose phosphate pathway
    BGM20_14325
   00051 Fructose and mannose metabolism
    BGM20_14325
  09102 Energy metabolism
   00680 Methane metabolism
    BGM20_14325
Enzymes [BR:bgi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     BGM20_14325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2
Motif
Other DBs
NCBI-ProteinID: AOL31736
Position
2787528..2789453
Genome map
AA seq 641 aa AA seqDB search
MESKYLDLLAQKYDCEEKVVTEIINLKAILNLPKGTEHFVSDLHGEYQAFQHVLRNGSGR
VKEKIRDIFSGVIYDREIDELAALVYYPEDKLKLIKHDFDAKAALNEWYKETINRMIKLV
SYCSSKYTRSKLRKALPTQFAYITEELLYKTEQAGNKEQYYSEIIDQIIELGQADKLITG
LAYSVQRLVVDHLHVVGDIYDRGPQPDRIMEELINYHSVDIQWGNHDVLWIGAYAGSKVC
LANIIRICARYDNLDIIEDVYGINLRPLLNLAEKYYDDNPAFRPKADDNRPEDEIKQITK
IHQAIAMIQFKLESPIIKRRPNFNMEERLLLEKIDYDKNEITLNGKTYQLENTCFATINP
EQPDQLLEEETEVIDKLLFSVQHSEKLGRHMNFMMKKGSLYLKYNGNLLIHGCIPVDENG
NMETMMIEDKPYAGRELLDVFERFLREAFAHPEETDDLATDMAWYLWTGEYSSLFGKRAM
TTFERYFIKEKETHKEKKNPYYYLREDEATCRNILAEFGLNPDHGHIINGHTPVKEIEGE
DPIKANGKMIVIDGGFSKAYQSTTGIAGYTLLYNSYGMQLVAHKHFNSKAEVLSTGTDVL
TVKRLVDKELERKKVKETNVGEELLQEVAILESLREYRYMK
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
ttggaaagcaagtacctagatctactcgcgcaaaaatacgattgtgaagaaaaagtggta
acagaaatcattaatttgaaagcgatattgaacctgccaaagggcaccgagcattttgtc
agtgatttgcacggggagtatcaggcattccagcacgtgctgcgcaatggttcaggacga
gtcaaagagaagatacgcgacattttcagcggtgtcatttacgatagagaaatcgatgaa
ttagcagcactggtctattatccggaagacaaactgaagttaatcaaacatgactttgat
gcgaaagcagcattaaacgagtggtataaagaaacgattaaccgaatgattaagctcgtt
tcatattgctcctccaagtatacccgctccaaactgcgcaaagcactgcctactcagttt
gcttatattacggaggagctgctatacaaaacagaacaagcaggcaacaaggagcaatat
tactccgaaatcattgatcagatcattgagcttggccaagccgataagctgatcaccggc
cttgcttacagcgttcagcggctggtggtcgaccatctgcatgtggtcggcgatatttac
gaccgcggcccgcagccggataggattatggaagaactgatcaactatcattctgtcgat
attcagtggggaaatcacgatgtcctttggatcggagcctatgccgggtccaaagtgtgc
ttggccaatattatccgcatctgtgcccgctacgataacttggatattattgaagacgtg
tacggcatcaacctgagaccgctgctgaacctggccgaaaaatattacgatgataatcca
gcgttccgtccaaaagcagacgacaacaggccagaggatgagattaagcaaatcacaaaa
atccatcaagcgattgcgatgatccaattcaagcttgagagtccgattatcaagagacgg
ccgaactttaatatggaagagcggctgttattagagaaaatagattatgacaaaaacgaa
atcacgctaaacggaaaaacatatcaattggaaaacacctgctttgcgacgattaatccg
gagcagccagatcagctattagaagaagaaacagaagtcatagacaagctgctgttctct
gtccagcattccgaaaagctgggccgtcatatgaattttatgatgaaaaaaggcagcctt
tatttaaaatataacggcaacctgttgattcacggctgtattcctgtcgatgaaaacggc
aatatggaaacgatgatgattgaggataaaccgtatgcgggccgtgagctgctcgatgta
tttgaacgattcttacgggaagcctttgcccacccggaagaaaccgatgacctggcgaca
gatatggcctggtatttatggacaggcgaatactcctctctcttcggaaaacgggccatg
acgacatttgagcggtatttcattaaagagaaggaaacgcataaagaaaagaaaaacccg
tattattatttacgcgaggacgaggcaacctgccgaaacatcctggcagaattcggcctc
aatccagatcatggccatatcatcaacggccatacaccggtaaaagaaatcgaaggagaa
gacccaatcaaagcaaacggaaaaatgatcgtcatcgacggcggcttctccaaagcctac
caatccacaacaggcatcgccggctacacactgctatacaactcctacggcatgcagctc
gtcgcccataaacacttcaactccaaggcagaagtcctaagcaccggaaccgacgtctta
acggtcaaacgattagtggacaaagaacttgagcggaagaaagtgaaggaaacgaatgtg
ggtgaggaactgttgcaggaagtagcgattttggagagtttgcgggagtatcggtatatg
aagtga

DBGET integrated database retrieval system